CCL25 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CCL25 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237305

Product Name CCL25 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 9kDa/16kDa
Cellular Location Secreted
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-150 of human CCL25 (NP_005615.2).
Isotype IgG
Observed Mw Refer to Figures
Product Background This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants.
Purification Method Affinity purification
Recommended Dilution WB
Sequence QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Species Reactivity Human
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.