TAGLN Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TAGLN Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237480

Product Name TAGLN Polyclonal Antibody
Application WB;IF
Application Key Western blotting
Calculated Mw 22kDa
Cellular Location Cytoplasm
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human TAGLN (NP_001001522.1).
Isotype IgG
Observed Mw 20kDa
Product Background The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene.
Positive Samples HT-29,Mouse heart,Mouse kidney,Rat kidney,Rat kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.