BCAS3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

BCAS3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237888

Product Name BCAS3 Polyclonal Antibody
Application WB;IHC;IF;IP
Application Key Western blotting
Calculated Mw 74kDa/99kDa/101kDa/102kDa/103kDa
Cellular Location Cytoplasm,Nucleus,cytoskeleton
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 674-913 of human BCAS3 (NP_060149.3).
Isotype IgG
Observed Mw 115kDa
Positive Samples HeLa,BT474,Rat brain
Purification Method Affinity purification
Recommended Dilution WB
Sequence LAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.