HLA-DRB1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

HLA-DRB1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-238210

Product Name HLA-DRB1 Polyclonal Antibody
Application WB;IF
Application Key Western blotting
Calculated Mw 30kDa
Cellular Location Cell membrane,Endoplasmic reticulum membrane,Endosome membrane,Golgi apparatus,Late endosome membrane,Lysosome membrane,Single-pass type I membrane protein,trans-Golgi network membrane
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-230 of human HLA-DRB1 (NP_002115.2).
Isotype IgG
Observed Mw 30kDa
Product Background HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.
Positive Samples MCF7,Mouse thymus,Mouse spleen,Mouse heart
Purification Method Affinity purification
Recommended Dilution WB
Sequence GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLS
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Last Modified Mar 08 2019