RARRES3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

RARRES3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-238948

Product Name RARRES3 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 17kDa/18kDa
Cellular Location Membrane,Single-pass membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RARRES3 (NP_004576.2).
Isotype IgG
Observed Mw 18kDa
Product Background Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator.
Positive Samples 293T
Purification Method Affinity purification
Recommended Dilution WB
Sequence MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKV
Species Reactivity Human
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.