PBXIP1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PBXIP1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-238951

Product Name PBXIP1 Polyclonal Antibody
Application WB;IHC
Application Key Western blotting
Calculated Mw 72kDa/77kDa/80kDa
Cellular Location Cytoplasm,Nucleus,cytoskeleton
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PBXIP1 (NP_065385.2).
Isotype IgG
Observed Mw 110kDa
Product Background The protein encoded by this gene interacts with the PBX1 homeodomain protein, inhibiting its transcriptional activation potential by preventing its binding to DNA. The encoded protein, which is primarily cytosolic but can shuttle to the nucleus, also can interact with estrogen receptors alpha and beta and promote the proliferation of breast cancer, brain tumors, and lung cancer. Several transcript variants encoding different isoforms have been found for this gene. More variants exist, but their full-length natures have yet to be determined.
Positive Samples HeLa,LO2,BT-474,A-549
Purification Method Affinity purification
Recommended Dilution WB
Sequence MASCPDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIREEGRCSSSDDDTDVDMEGLRRRRGREAGPPQPMVPLAVENQAGGEGAGGE
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.