PMPCA Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PMPCA Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-239512

Product Name PMPCA Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 44kDa/58kDa
Cellular Location Mitochondrion matrix
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 456-525 of human PMPCA (NP_055975.1).
Isotype IgG
Observed Mw 110kDa
Product Background The protein encoded by this gene is found in the mitochondrion, where it represents the alpha subunit of a proteolytic heterodimer. This heterodimer is responsible for cleaving the transit peptide from nuclear-encoded mitochondrial proteins. Defects in this gene are a cause of spinocerebellar ataxia, autosomal recessive 2.
Positive Samples 293T,MCF7,Raji,HeLa
Purification Method Affinity purification
Recommended Dilution WB
Sequence TRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.