MCF2L Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

MCF2L Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-239513

Product Name MCF2L Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 102-128kDa
Cellular Location Cell membrane,Cytoplasm,Cytoplasmic side,Peripheral membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 850-980 of human MCF2L (NP_079255.4).
Isotype IgG
Observed Mw 128kDa
Product Background This gene encodes a guanine nucleotide exchange factor that interacts specifically with the GTP-bound Rac1 and plays a role in the Rho/Rac signaling pathways. A variant in this gene was associated with osteoarthritis. Alternative splicing results in multiple transcript variants.
Positive Samples MCF7,Mouse heart,Mouse kidney,Mouse lung
Purification Method Affinity purification
Recommended Dilution WB
Sequence YEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEK
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.