ANAPC13 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

ANAPC13 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-239514

Product Name ANAPC13 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 8kDa
Cellular Location Nucleus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human ANAPC13 (NP_056206.1).
Isotype IgG
Observed Mw 15kDa
Product Background This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined.
Positive Samples 293T,MCF7,Mouse heart
Purification Method Affinity purification
Recommended Dilution WB
Sequence MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.