JAM2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

JAM2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-239525

Product Name JAM2 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 29kDa/33kDa/34kDa
Cellular Location Cell junction,Cell membrane,Single-pass type I membrane protein,tight junction
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-238 of human JAM2 (NP_067042.1).
Isotype IgG
Observed Mw 50kDa
Product Background This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene.
Positive Samples A-549,SH-SY5Y,HeLa
Purification Method Affinity purification
Recommended Dilution WB
Sequence FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Species Reactivity Human
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.