SAV1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SAV1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-239527

Product Name SAV1 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 44kDa
Cellular Location Cytoplasm,Nucleus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human SAV1 (NP_068590.1).
Isotype IgG
Observed Mw 45kDa
Product Background WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein with two WW domains, a SARAH domain, and a coiled-coil region and is ubiquitously expressed in adult tissues. This protein binds to MST1 (mammalian sterile 20-like kinase 1) and promotes MST1-induced apoptosis. It has also been shown to bind to HAX1 (hematopoietic cell-specific protein 1 (HS1)-associated protein X-1) and to attenuate the anti-apoptotic effects of HAX1. Studies in human and mouse suggest this gene acts as a tumor suppressor.
Positive Samples HeLa,SKOV3,SW480
Purification Method Affinity purification
Recommended Dilution WB
Sequence MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAFSTSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFFDGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLPLPPGWSVDWT
Species Reactivity Human
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.