BCL2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

BCL2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-240641

Product Name BCL2 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 22kDa/26kDa
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BCL2 (NP_000624.2).
Isotype IgG
Observed Mw 26kDa
Product Background This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.
Positive Samples 293T,HeLa,mouse lung,mouse testis
Purification Method Affinity purification
Recommended Dilution WB
Sequence MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.