CAMK4 Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog No: bt-240642
| Product Name | CAMK4 Polyclonal Antibody |
|---|---|
| Application | WB |
| Application Key | Western blotting |
| Calculated Mw | 51kDa |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 304-473 of human CAMK4 (NP_001735.1). |
| Isotype | IgG |
| Observed Mw | Refer to figures |
| Product Background | The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. |
| Purification Method | Affinity purification |
| Recommended Dilution | WB |
| Sequence | AANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY |
| Species Reactivity | Rat |
| Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |