CCR2 Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog Number: BT-228757
| Product Name | CCR2 Polyclonal Antibody |
|---|---|
| Application | WB |
| Application Key | Western blotting |
| Calculated Mw | 41kDa |
| Cellular Location | Cell membrane,Multi-pass membrane protein |
| Customer Validation | ELISA (Bacteria) |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 315-374 of human CCR2 (NP_001116513.2). |
| Isotype | IgG |
| Observed Mw | 50kDa |
| Product Background | This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. |
| Positive Samples | THP-1,Mouse heart |
| Purification Method | Affinity purification |
| Recommended Dilution | WB |
| Reference | Product: CCR2 Polyclonal Antibody Journal: Molecular pharmaceutics Application: ELISA IF: 4.44 Species: Bacteria PMID: 29791797 Title: Modulating macrophage polarization through CCR2 inhibition and multivalent engagement |
| Sequence | LFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA |
| Species Reactivity | Human, Mouse |
| Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Last Modified | Jul 26 2021 |