WSB2 Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog Number: BT-231619
| Product Name | WSB2 Polyclonal Antibody |
|---|---|
| Application | WB |
| Application Key | Western blotting |
| Calculated Mw | 21kDa/45kDa/47kDa |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human WSB2 (NP_061109.1). |
| Isotype | IgG |
| Observed Mw | 40-43kDa |
| Product Background | This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases. Three transcript variants encoding different isoforms have been found for this gene. |
| Positive Samples | Mouse kidney,Rat kidney,Rat spleen |
| Purification Method | Affinity purification |
| Recommended Dilution | WB |
| Sequence | MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWV |
| Species Reactivity | Mouse, Rat |
| Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Last Modified | Jul 26 2021 |