PARN Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog Number: BT-235896
| Product Name | PARN Polyclonal Antibody |
|---|---|
| Application | WB;IHC;IF |
| Application Key | Western blotting |
| Calculated Mw | 52kDa/66kDa/67kDa/73kDa |
| Cellular Location | Cytoplasm,Nucleus,nucleolus |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PARN (NP_002573.1). |
| Isotype | IgG |
| Observed Mw | 73kDa |
| Product Background | The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Positive Samples | MCF7,HepG2 |
| Purification Method | Affinity purification |
| Recommended Dilution | WB |
| Sequence | MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANS |
| Species Reactivity | Human |
| Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Last Modified | Jul 26 2021 |