Recombinant Human EGF Protein Recombinant Proteins Recombinant Human Epidermal Growth Factor / EGF is produced in E.coli and the target gene encoding Asn971-Arg1023 is expressed 6.2 kDa
$ $99 In stock
Formulation: 6.2 kDa
Source: E.coli
Usage: Our products are for RESEARCH USE ONLY!

Recombinant Human EGF Protein

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog Number: BT-200001

Molecular Weight: 6.2 kDa

Formulation: Human EGF Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, pH 8.0.

Source: E.coli

Product Name Recombinant Human EGF Protein
Molecular Weight 6.2 kDa
AA Sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Bioactivity ED50 of human egf protein is less than 2 ng/ml.
Endotoxin Less than 0.1 ng/µg (1 EU/µg) as determined by LAL test
Formulation Human EGF Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, pH 8.0.
Host Species Homo sapiens (Human)
Description Recombinant Human Epidermal Growth Factor / EGF is produced in E.coli and the target gene encoding Asn971-Arg1023 is expressed
Product Background Epidermal growth factor (EGF) stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is a 6-kDa protein with 53 amino acid residues and three intramolecular disulfide bonds. EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues including submandibular gland (submaxillary gland) and parotid gland. Initially, human EGF was known as urogastrone.
Product Type Recombinant Protein
Purity Greater than 95% as determined by reducing SDS-PAGE.
Reconstitution Dissolve the lyophilized human EGF Protein in distilled water
Source E.coli
Stability Recombinant egf Proteins are stable for up to 1 year from date of receipt at -70℃
Storage Lyophilized human egf protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted EGF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Synonym Pro-Epidermal Growth Factor, EGF, Epidermal Growth Factor, Urogastrone
Uniprot No P01133
Usage Our products are for RESEARCH USE ONLY!
Last Modified Aug 20 2021