Recombinant Canine IL31 Protein (His Tag) Recombinant Proteins Recombinant Canine IL31 Protein produced in Mammalian Cells is a single, glycosylated polypeptide chain containing 142aa (24-159a.a.). IL31 canine is fused to a His tag at C-terminus Calculated molecular weight of canine il31 protein is 16.2 kDa (Signal peptide excluded)
$ $99 In stock
Formulation: Calculated molecular weight of canine il31 protein is 16.2 kDa (Signal peptide excluded)
Source: Mammalian Cells
Usage: For Research Use Only

Recombinant Canine IL31 Protein (His Tag)

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog Number: BT-200019

Molecular Weight: Calculated molecular weight of canine il31 protein is 16.2 kDa (Signal peptide excluded)

Formulation: Liquid solution. The recombinant canine IL31 protein was supplied in 20mM PB, 150mM NaCl, pH7.4

Source: Mammalian Cells

Product Name Recombinant Canine IL31 Protein (His Tag)
Molecular Weight Calculated molecular weight of canine il31 protein is 16.2 kDa (Signal peptide excluded)
AA Sequence SHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHH*
Endotoxin < 1.0 EU per μg of the IL31 protein as determined by the LAL method
Formulation Liquid solution. The recombinant canine IL31 protein was supplied in 20mM PB, 150mM NaCl, pH7.4
Host Species Canine
Description Recombinant Canine IL31 Protein produced in Mammalian Cells is a single, glycosylated polypeptide chain containing 142aa (24-159a.a.). IL31 canine is fused to a His tag at C-terminus
Product Background Interleukin-31 (IL-31) is a member of the gp130/interleukin-6 cytokine family that is produced by cell types such as T helper 2 lymphocytes and cutaneous lymphocyte antigen positive skin homing T cells. When overexpressed in transgenic mice, IL-31 induces severe pruritus, alopecia and skin lesions. In humans, IL-31 serum levels correlate with the severity of atopic dermatitis in adults and children.IL-31 is an inflammatory cytokine that helps trigger cell-mediated immunity against pathogens. It has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. IL-31 is produced by a variety of cells, namely type 2 helper (TH2) T-cells. IL-31 sends signals through a receptor complex made of IL-31RA and oncostatin M receptor β (OSMRβ) expressed in immune and epithelial cells. These signals activate three pathways: ERK1/2 MAP kinase, PI3K/AKT, and JAK1/2 signaling pathways.
Product Memo ecombinant Dog IL31 Protein, IL31 Dog, IL-31, Canine Recombinant
Product Type Recombinant Protein
Purity > 90% as determined by SDS-PAGE.
Source Mammalian Cells
Stability Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Storage Store canine il31 protein at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid repeated freeze thaw cycles.
Synonym IL31, IL-31, interleukin 31
Uniprot No C7G0W1
Usage For Research Use Only
Last Modified Aug 20 2021