Recombinant Human PRL R Protein Recombinant Proteins
$ $99 In stock
Formulation:
Source: E.coli
Usage: Our recombinant proteins are For Research Use Only. This product is not intended or approved for human, diagnostics or veterinary use

Recombinant Human PRL R Protein

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-222333

Formulation: The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.

Source: E.coli

Product Name Recombinant Human PRL R Protein
AA Sequence AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH FGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYL WIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVR CKPDHGYWSAWSPATFIQIPSDFTMNDTTVW.
Bioactivity Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1 1 molar ratio.
Formulation The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.
Host Species Homo sapiens (Human)
Product Background Prolactin is a pituitary hormone that plays a role in the stimulation of milk production, salt and water regulation, growth, development and reproduction. The primary step in its action is the binding to a specific membrane receptor (prolactin receptor) which belongs to the superfamily of class 1 cytokine receptors. Prolactin is a hormone involved in a range of significant functions including ion transport and osmoregulation, stimulation of milk, protein synthesis as well as the regulation of numerous reproductive functions. Prolactin exerts its influence on different cell types through a signal transduction pathway which begins with the binding of the hormone to a transmembrane Prolactin receptor. PRLR varies in size (short and long forms) with tissue source and species, from ~40 kDa to 100 kDa. The PRL-R consists of at least 3 separate domains: an extracellular region with 5 cysteines which contains the prolactin binding site, a single transmembrane domain and a cytoplasmic region, the length of which appears to influence ligand binding and regulate cellular function.
Product Memo PRL R Human Prolactin Soluble Receptor Human Recombinant
Product Type Recombinant Protein
Purity >97% as determined by SEC-HPLC and SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions
Reconstitution It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions
Source E.coli
Stability Recombinant protein is stable up to 1 year at -80℃
Storage Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored under sterile conditions at -20°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -20°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.
Synonym PRL-R, hPRLrI
Uniprot No P16471
Usage Our recombinant proteins are For Research Use Only. This product is not intended or approved for human, diagnostics or veterinary use
Last Modified Mar 08 2019