Recombinant Human PROC Protein Recombinant Proteins
$ $99 In stock
Formulation:
Source: HEK 293 cells.
Usage: Our recombinant proteins are For Research Use Only. This product is not intended or approved for human, diagnostics or veterinary use

Recombinant Human PROC Protein

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-222337

Formulation: PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.

Source: HEK 293 cells.

Product Name Recombinant Human PROC Protein
AA Sequence MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW QVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIK EVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGW GYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE GDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAP QKSWAPEFHHHHHHHH.The first 32aa are predicted as signal peptide.
Formulation PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
Host Species Homo sapiens (Human)
Product Background Protein C (PROC) is a vitamin K-dependent serine protease which regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids. PROC is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form, which contains a serine protease domain, functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in the PROC gene are linked with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis. Protein C is synthesized as a single chain precursor, which is cleaved into a light and a heavy chain held together by a disulfide bond. The enzyme is at that time activated by thrombin, which cleaves a tetradecapeptide from the amino end of the heavy chain; this reaction, which occurs at the surface of endothelial cells, is intensely promoted by thrombomodulin.
Product Memo PROC Human Protein-c Human Recombinant
Product Type Recombinant Protein
Purity >80% as determined by SDS-PAGE.
Source HEK 293 cells.
Stability Recombinant protein is stable up to 1 year at -80℃
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Synonym Vitamin K-dependent protein C, Anticoagulant protein C, Autoprothrombin IIA, Blood coagulation factor XIV, PROC, PC, APC, PROC1, THPH3, THPH4
Uniprot No P04070
Usage Our recombinant proteins are For Research Use Only. This product is not intended or approved for human, diagnostics or veterinary use
Last Modified Mar 08 2019