Recombinant Human SYK Protein Recombinant Proteins
$ $99 In stock
Formulation:
Source: HEK 293 cells.
Usage: Our recombinant proteins are For Research Use Only. This product is not intended or approved for human, diagnostics or veterinary use

Recombinant Human SYK Protein

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-223004

Formulation: SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.

Source: HEK 293 cells.

Product Name Recombinant Human SYK Protein
AA Sequence MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN.
Formulation SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
Host Species Homo sapiens (Human)
Product Background Spleen Tyrosine Kinase (SYK) belongs to the family of non-receptor type Tyr protein kinases. The SYK protein is extensively expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events which mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. SYK is considered to be a modulator of epithelial cell growth and a likely tumor suppressor in human breast carcinomas. SYK is a positive effector of BCR-stimulated responses. SYK connects the B-cell antigen receptor (BCR) to the utilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway, when phosphorylated on Tyr-348 and Tyr-352. Therefore the differential phosphorylation of Syk can define the pathway by which BCR is coupled to the regulation of intracellular calcium ion (By similarity). SYK also phosphorylates USP25 and regulates its intracellular levels.
Product Memo SYK Human Spleen Tyrosine Kinase Human Recombinant
Product Type Recombinant Protein
Purity >85% as determined by SDS-PAGE.
Source HEK 293 cells.
Stability Recombinant protein is stable up to 1 year at -80℃
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Synonym Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK
Uniprot No P43405
Usage Our recombinant proteins are For Research Use Only. This product is not intended or approved for human, diagnostics or veterinary use