RAB11FIP2 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to RAB11FIP2 Protein

RAB11FIP2 (RAB11 Family Interacting Protein 2) functions as an adapter protein that plays essential roles in the secretory pathway. It serves as a Rab11 effector binding preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA), regulating vesicle transport from the endosomal recycling compartment (ERC) to the plasma membrane . The protein is also involved in insulin granule exocytosis, receptor-mediated endocytosis, and membrane trafficking of recycling endosomes, likely originating from clathrin-coated vesicles .

In humans, the canonical protein has a reported length of 512 amino acid residues with a molecular weight of approximately 58.3 kDa . The protein is widely expressed across various tissue types and exhibits subcellular localization primarily in cell projections and cell membranes . RAB11FIP2 is known to undergo post-translational modifications, particularly phosphorylation, which may regulate its functions .

The protein is also referred to by several synonyms including nRip11, Rab11-FIP2, RFIP2, and RAB11 family interacting protein 2 (class I) . Gene orthologs have been reported in multiple species including mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken .

Types and Formats

RAB11FIP2 antibodies are available in multiple formats based on clonality, host species, and preparation methods. The two primary types include:

Antibody TypeCharacteristicsCommon Applications
PolyclonalGenerated from multiple B cell lineages, recognizes multiple epitopesWB, IHC, ICC/IF
MonoclonalDerived from a single B cell clone, targets a specific epitopeWB, ICC/IF, Flow Cytometry, IHC-P

Most commercially available RAB11FIP2 antibodies are produced in rabbits, though other host species may be available . These antibodies are typically offered in unconjugated formats, though some suppliers may provide conjugated versions for specialized applications .

Immunogens and Epitope Recognition

RAB11FIP2 antibodies are generated using various immunogens, including:

  1. Synthetic peptides corresponding to specific regions of the RAB11FIP2 protein

  2. Recombinant proteins representing partial or complete RAB11FIP2 sequences

  3. KLH-conjugated synthetic peptides from targeted regions

The immunogen selection significantly impacts the antibody's specificity and application range. For instance, the antibody described in source was generated using a KLH-conjugated synthetic peptide between amino acids 345-374 from the central region of human RAB11FIP2, while another antibody was developed against a recombinant protein corresponding to a specific amino acid sequence: HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN .

Applications of RAB11FIP2 Antibodies

RAB11FIP2 antibodies have demonstrated utility across multiple research applications, each requiring specific protocols and optimization.

Western Blotting (WB)

Western blotting represents one of the most common applications for RAB11FIP2 antibodies. The recommended working dilutions typically range from 0.04-0.4 μg/ml to 1:1000, depending on the specific antibody and manufacturer . In Western blot analyses, RAB11FIP2 is typically detected at approximately 58 kDa, consistent with its predicted molecular weight .

Immunohistochemistry (IHC)

For immunohistochemistry applications, particularly IHC-Paraffin (IHC-P), RAB11FIP2 antibodies are typically used at dilutions ranging from 1:20 to 1:50 . Heat-induced epitope retrieval (HIER) at pH 6 is generally recommended for optimal staining results . Notably, immunohistochemical staining of human stomach tissue has shown strong cytoplasmic positivity in glandular cells when using certain RAB11FIP2 antibodies .

Immunocytochemistry/Immunofluorescence (ICC/IF)

For ICC/IF applications, RAB11FIP2 antibodies are typically used at concentrations of 0.25-2 μg/ml . Immunofluorescent staining of human cell lines (e.g., U-2 OS) has demonstrated localization of RAB11FIP2 to vesicular structures, consistent with its role in vesicle transport and endosomal recycling . For optimal results, fixation with paraformaldehyde (PFA) and permeabilization with Triton X-100 are recommended .

Flow Cytometry

Several RAB11FIP2 antibodies are validated for intracellular flow cytometry applications, with recommended dilutions typically ranging from 1:10 to 1:50 . This application allows for quantitative analysis of RAB11FIP2 expression at the single-cell level.

Species Reactivity and Cross-Reactivity

The species reactivity of RAB11FIP2 antibodies varies by product. Many antibodies are specifically validated for human samples, while others demonstrate cross-reactivity with mouse and rat tissues . This cross-reactivity is often predictable based on sequence homology between species. For instance, some immunogens show approximately 86% sequence identity between human and mouse/rat RAB11FIP2 .

SpeciesValidation StatusNotes
HumanMost commonly validatedPrimary target for most antibodies
MouseValidated for some antibodies~86% sequence identity to human in some regions
RatValidated for some antibodies~86% sequence identity to human in some regions
Other speciesPredicted reactivityBased on sequence homology

RAB11FIP2 in Cancer Research

RAB11FIP2 has emerged as an important research target in cancer biology, particularly in gastric cancer. A study by Liu et al. (2016) demonstrated that the expression level of RAB11FIP2 was significantly increased in gastric cancer tissues compared to normal tissues . Furthermore, high expression of RAB11FIP2 was closely correlated with nodal metastasis in gastric cancer patients .

The study revealed that RAB11FIP2 overexpression promoted epithelial-mesenchymal transition (EMT), a process associated with cancer metastasis, both in vitro and in vivo . Interestingly, the researchers also found that hypoxia could enhance the expression of RAB11FIP2 through HIF-1α, and inactivation of RAB11FIP2 dramatically decreased hypoxia-induced migration of gastric cancer cells .

Molecular Mechanisms

At the molecular level, RAB11FIP2 appears to function through multiple mechanisms:

  1. Regulation of EGFR internalization: Suppression of EGFR internalization plays an important role in EMT induced by overexpression of RAB11FIP2 in gastric cancer cells .

  2. Actin cytoskeleton dynamics: RAB11FIP2 can regulate actin cytoskeleton dynamics, which is crucial for cell migration and metastasis .

  3. Complex formation with MYO5B and RAB11: RAB11FIP2 is required in a complex with MYO5B and RAB11 for the transport of NPC1L1 to the plasma membrane .

  4. Phagocytosis regulation: RAB11FIP2 plays an essential role in phagocytosis through a mechanism involving TICAM2, RAC1, and CDC42 Rho GTPases for controlling actin dynamics .

These findings suggest that RAB11FIP2 may represent a promising candidate target for cancer treatment, particularly for gastric cancer .

Optimal Dilutions and Controls

When working with RAB11FIP2 antibodies, it's essential to optimize dilutions for specific applications and experimental conditions. While manufacturers provide recommended dilutions, these may require adjustment based on the specific sample type, detection method, and desired signal strength.

ApplicationTypical Dilution RangeNotes
Western Blot0.04-1 μg/ml or 1:1000May need optimization for different cell/tissue lysates
IHC-P1:20-1:50HIER pH 6 retrieval recommended
ICC/IF0.25-2 μg/mlPFA fixation, Triton X-100 permeabilization recommended
Flow Cytometry1:10-1:50For intracellular staining

Positive controls for RAB11FIP2 antibody validation include human cell lines such as COLO205 and U-2 OS, which have been demonstrated to express detectable levels of the protein .

Potential Cross-Reactivity Considerations

While many RAB11FIP2 antibodies are designed to be specific, the possibility of cross-reactivity with related proteins should be considered, particularly when working with polyclonal antibodies. The RAB11 family contains multiple interacting proteins (FIPs) with some sequence similarity, which may lead to cross-reactivity in certain applications.

Future Research Directions

Research into RAB11FIP2 and applications of RAB11FIP2 antibodies continues to evolve. Several promising directions include:

  1. Further elucidation of RAB11FIP2's role in cancer progression and metastasis, building on findings from gastric cancer studies .

  2. Investigation of RAB11FIP2 as a potential therapeutic target or biomarker for cancer diagnosis and prognosis.

  3. Deeper understanding of RAB11FIP2's interactions with other proteins in vesicle trafficking pathways, particularly its relationship with MYO5B and RAB11.

  4. Development of more specific and sensitive antibodies, including those targeting specific post-translational modifications of RAB11FIP2.

  5. Exploration of RAB11FIP2's functions in additional physiological and pathological contexts beyond cancer, including its role in normal cellular processes and other disease states.

Product Specs

Form
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Lead Time
Typically, we can ship the products within 1-3 business days after receiving your orders. Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Synonyms
KIAA0941 antibody; NRip11 antibody; RAB11 family interacting protein 2 (class I) antibody; Rab11 family-interacting protein 2 antibody; RAB11 FIP2 long isoform antibody; Rab11-FIP2 antibody; RAB11FIP2 antibody; RFIP2 antibody; RFIP2_HUMAN antibody
Target Names
Uniprot No.

Target Background

Function
RAB11FIP2 is a Rab11 effector that exhibits a preference for binding to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA). It plays a critical role in regulating the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane. This protein is involved in insulin granule exocytosis, receptor-mediated endocytosis, and the membrane trafficking of recycling endosomes, likely originating from clathrin-coated vesicles. RAB11FIP2 is required, in complex with MYO5B and RAB11, for the transport of NPC1L1 to the plasma membrane. Furthermore, it serves as a regulator of cell polarity. RAB11FIP2 plays a vital role in phagocytosis, employing a mechanism involving TICAM2, RAC1, and CDC42 Rho GTPases to control actin dynamics.
Gene References Into Functions
  1. miR-142-3p, a microRNA enriched in exosomes during acute cellular rejection, is transferred to endothelial cells and impairs endothelial barrier function by downregulating RAB11FIP2. PMID: 28073833
  2. The interaction of Eps15 and Rab11-FIP2 at the appropriate time and location in polarizing cells is crucial for the proper establishment of epithelial polarity. PMID: 28228550
  3. Our research suggests a potential role of Rab11-FIP2 in tumor progression and provides novel insights into the mechanism by which Rab11-FIP2 positively regulates cell migration and invasion in CRC cells. PMID: 26792722
  4. Our findings unveil a novel mechanism underlying the role of Rab11-FIP2 in gastric cancer dissemination. PMID: 26502090
  5. Rab11-FIP2 binding to MYO5B is essential for vesicular trafficking in Hela and MDCK cells. PMID: 24372966
  6. The recruitment of FIP2 is specific, as other members of the Rab11-Family of Interacting Proteins do not associate with the chlamydial inclusions. PMID: 23006599
  7. The Rab11A/myosin Vb/Rab11-FIP2 complex orchestrates two late recycling steps of langerin from the ERC to the plasma membrane. PMID: 22420646
  8. Rab11-FIP2 functions downstream of Rab11 in endosomal trafficking. PMID: 11994279
  9. Rab11-FIP2 regulates trafficking at multiple points within the apical recycling system of polarized cells. PMID: 17626244
  10. The FIP2 C2 mutant caused a failure at the final budding step in the RSV virus life cycle. PMID: 18621683
  11. Phosphorylation of Rab11-FIP2 on serine 227 by MARK2 regulates an alternative pathway modulating the establishment of epithelial polarity. PMID: 16775013

Show More

Hide All

Database Links

HGNC: 29152

OMIM: 608599

KEGG: hsa:22841

STRING: 9606.ENSP00000347839

UniGene: Hs.173656

Subcellular Location
Cell projection, phagocytic cup. Cell membrane; Peripheral membrane protein. Recycling endosome membrane; Peripheral membrane protein. Note=Translocates with RAB11A from the vesicles of the endocytic recycling compartment (ERC) to the plasma membrane.

Q&A

What is RAB11FIP2 and what are its key biological functions?

RAB11FIP2 (RAB11 family interacting protein 2) is a 58.3 kDa protein comprising 512 amino acid residues in humans. It primarily localizes to cell projections and cell membranes, with up to two documented isoforms. This protein functions as a Rab11 effector that preferentially binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA) .

RAB11FIP2 plays critical roles in:

  • Regulating vesicular transport from endosomal recycling compartments (ERC) to the plasma membrane

  • Modulating receptor-mediated endocytosis and membrane trafficking of recycling endosomes

  • Participating in insulin granule exocytosis

  • Forming complexes with MYO5B and RAB11 to transport NPC1L1 to the plasma membrane

  • Regulating cell polarity

  • Facilitating phagocytosis through mechanisms involving TICAM2, RAC1, and CDC42 Rho GTPases for actin dynamics control

  • Negatively regulating AMPAR synaptic trafficking in neuronal cells

How do monoclonal and polyclonal RAB11FIP2 antibodies differ in research applications?

Monoclonal and polyclonal RAB11FIP2 antibodies present distinct characteristics affecting their experimental utility:

Polyclonal RAB11FIP2 antibodies:

  • Recognize multiple epitopes on the RAB11FIP2 protein

  • Typically offer higher sensitivity but potentially lower specificity

  • Recommended for applications requiring strong signal detection such as Western blotting (1:2000-1:12000 dilution) and immunofluorescence (1:50-1:500 dilution)

  • Useful for detecting native conformations of RAB11FIP2 in various species including human, mouse, and rat

  • Example: Rabbit polyclonal antibodies (catalog 18136-1-AP) consistently detect the 58 kDa band in Western blots

Monoclonal RAB11FIP2 antibodies:

  • Target a single epitope with high specificity

  • Provide consistent results between experiments with minimal batch variation

  • Particularly effective for applications requiring high specificity like immunohistochemistry

  • Example: Rabbit recombinant monoclonal antibody [EPR12294-85] suitable for Western blot, ICC/IF, flow cytometry, and IHC-P applications

  • Ideal for experiments involving complex samples where cross-reactivity must be minimized

Selection between these antibody types should be based on the specific experimental requirements, target tissues, and detection methods.

What model systems are most appropriate for studying RAB11FIP2 function?

Several model systems have demonstrated effectiveness for investigating RAB11FIP2 functions:

Cellular models:

  • HepG2 cells: Suitable for immunofluorescence studies examining RAB11FIP2 distribution and colocalization with cytoskeletal elements

  • HEK-293 cells: Effective for Western blot detection and protein interaction studies

  • Gastric cancer cell lines: Valuable for investigating RAB11FIP2's role in cancer metastasis and epithelial-mesenchymal transition

  • Neuronal cultures: Essential for examining RAB11FIP2's involvement in AMPA receptor trafficking and synaptic plasticity

Tissue models:

  • Mouse and rat brain tissue: Reliable for detecting endogenous RAB11FIP2 expression and studying its neuronal functions

  • Mouse liver tissue: Useful for examining metabolic roles of RAB11FIP2

  • Gastric cancer patient tissues: Valuable for correlating RAB11FIP2 expression with clinical features and prognosis

Animal models:

  • RAB11FIP2 orthologs have been reported in mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken, providing diverse options for in vivo studies

  • Rat hippocampal slices: Appropriate for studying RAB11FIP2's role in long-term potentiation and AMPAR trafficking

Selection of an appropriate model system should consider the specific RAB11FIP2 function under investigation and the availability of compatible antibodies with verified species reactivity.

What are the optimal protocols for RAB11FIP2 detection by Western blotting?

For optimal Western blot detection of RAB11FIP2:

Sample preparation:

  • Use RIPA buffer supplemented with protease inhibitors for cell lysis

  • Include phosphatase inhibitors if phosphorylated forms are of interest

  • Denature samples at 95°C for 5 minutes in Laemmli buffer with DTT or β-mercaptoethanol

Gel electrophoresis parameters:

  • Use 10% SDS-PAGE gels for optimal resolution of the 58 kDa RAB11FIP2 protein

  • Load 20-30 μg of total protein per lane for cell lysates; 40-50 μg for tissue samples

Transfer conditions:

  • Transfer proteins to PVDF membrane at 100V for 60-90 minutes in cold transfer buffer

  • Confirm transfer efficiency with Ponceau S staining

Antibody incubation:

  • Block membrane with 5% non-fat milk in TBST for 1 hour at room temperature

  • For polyclonal antibodies: Dilute 1:2000-1:12000 in blocking buffer

  • For monoclonal antibodies: Follow manufacturer's recommended dilution (typically 1:1000-1:5000)

  • Incubate with primary antibody overnight at 4°C

  • Wash 3 times with TBST, 5 minutes each

  • Incubate with HRP-conjugated secondary antibody (1:5000-1:10000) for 1 hour at room temperature

  • Wash 3 times with TBST, 5 minutes each

Detection:

  • Use enhanced chemiluminescence (ECL) reagents for detection

  • Expected band for RAB11FIP2: 58 kDa

  • Positive controls: Mouse brain tissue, mouse liver tissue, HEK-293 cells, rat brain tissue

Validation controls:

  • Include RAB11FIP2 knockdown or knockout samples as negative controls

  • For isoform-specific detection, verify band patterns with recombinant protein standards

This protocol consistently produces clear detection of RAB11FIP2 with minimal background and non-specific binding.

How can RAB11FIP2 localization be effectively studied through immunofluorescence techniques?

For optimal immunofluorescence detection of RAB11FIP2:

Sample preparation:

  • Cultured cells: Fix with cold (-20°C) ethanol for 10 minutes or 4% paraformaldehyde for 15 minutes

  • Tissue sections: Use 4% paraformaldehyde fixation followed by permeabilization with 0.2% Triton X-100

Blocking and permeabilization:

  • Block with 5% normal serum (goat or donkey) in PBS containing 0.1% Triton X-100 for 1 hour at room temperature

  • For membrane proteins, gentler permeabilization with 0.1% saponin may better preserve epitopes

Antibody incubation:

  • Dilute RAB11FIP2 antibody 1:50-1:500 in blocking buffer

  • Incubate overnight at 4°C in a humidified chamber

  • Wash 3 times with PBS, 5 minutes each

  • Incubate with fluorophore-conjugated secondary antibody (e.g., Goat Anti-Rabbit IgG conjugated to Alexa Fluor or CoraLite dyes) at 1:200-1:1000 dilution for 1 hour at room temperature

  • Wash 3 times with PBS, 5 minutes each

Co-staining recommendations:

  • Phalloidin (CL594-phalloidin): For actin cytoskeleton visualization and correlation with RAB11FIP2 distribution

  • Anti-RAB11 antibodies: To examine colocalization with recycling endosomes

  • Anti-EGFR antibodies: To study receptor internalization mechanisms

  • Anti-GluA1 antibodies: For AMPAR trafficking studies in neuronal cells

Image acquisition and analysis:

  • Use confocal microscopy for precise subcellular localization

  • Z-stack imaging for three-dimensional distribution analysis

  • Deconvolution techniques for improved resolution of vesicular structures

  • Quantify colocalization using Pearson's or Manders' coefficients

Controls:

  • Include secondary-only controls to assess background

  • Use RAB11FIP2 knockdown cells as negative controls

  • Consider competitors (blocking peptides) to confirm antibody specificity

This approach enables precise visualization of RAB11FIP2's subcellular distribution and its dynamic relationships with interaction partners and cellular structures.

What strategies are effective for analyzing RAB11FIP2 post-translational modifications?

RAB11FIP2 undergoes several post-translational modifications, particularly phosphorylation, which affects its function. Here are effective analytical strategies:

Phosphorylation analysis:

  • Phospho-specific antibodies:

    • Use antibodies that specifically recognize phosphorylated forms of RAB11FIP2

    • Combine with phosphatase inhibitors during sample preparation

    • Compare phosphorylation status before and after cellular stimulation

  • Phosphatase treatment:

    • Treat immunoprecipitated RAB11FIP2 with lambda phosphatase

    • Compare migration patterns on SDS-PAGE before and after treatment

    • Mobility shift often indicates dephosphorylation

  • Mass spectrometry approaches:

    • Immunoprecipitate RAB11FIP2 under native conditions

    • Perform tryptic digestion followed by LC-MS/MS

    • Search for phosphopeptides using appropriate software

    • Compare phosphorylation sites in different experimental conditions

  • Phos-tag SDS-PAGE:

    • Use Phos-tag acrylamide gels to separate phosphorylated from non-phosphorylated forms

    • Particularly useful for detecting RAB11FIP2 dephosphorylation during LTP

Experimental design considerations:

  • Include treatments that modulate phosphorylation (e.g., hypoxia which enhances RAB11FIP2 expression through HIF-1α)

  • For neuronal studies, compare phosphorylation before and after LTP induction

  • For cancer studies, compare phosphorylation patterns between normal and metastatic tissues

Controls and validation:

  • Use phosphomimetic and phospho-deficient mutants (S→E or S→A) to confirm functional consequences

  • Compare with known kinase inhibitors to identify regulatory pathways

  • Validate mass spectrometry findings with site-specific antibodies when available

This multi-faceted approach provides comprehensive analysis of RAB11FIP2 phosphorylation status under various physiological and pathological conditions.

How can RAB11FIP2-protein interactions be effectively characterized in different cellular contexts?

Characterizing RAB11FIP2 interactions requires multiple complementary approaches:

Co-immunoprecipitation strategies:

  • Endogenous IP:

    • Immunoprecipitate native RAB11FIP2 using validated antibodies

    • Use gentle lysis buffers (containing 0.5-1% NP-40 or Triton X-100) to preserve protein-protein interactions

    • Western blot for suspected binding partners (RAB11, MYO5B, AMPA receptors, etc.)

  • Tagged-protein approach:

    • Express epitope-tagged RAB11FIP2 (FLAG, HA, or GFP)

    • Perform pull-down with tag-specific antibodies

    • Identify novel interactions using mass spectrometry

    • Validate findings with reverse co-IP experiments

Proximity-based methods:

  • BioID or TurboID:

    • Generate RAB11FIP2 fusion with biotin ligase

    • Allow in-cell biotinylation of proximal proteins

    • Identify biotinylated proteins through streptavidin pull-down and mass spectrometry

    • Particularly valuable for identifying transient interactions

  • FRET or BRET analysis:

    • Generate fluorescent protein fusions of RAB11FIP2 and potential partners

    • Measure energy transfer as indicator of protein proximity

    • Useful for quantifying interaction dynamics in living cells

Domain-specific interaction mapping:

  • Deletion mutants:

    • Generate systematic truncations of RAB11FIP2

    • Identify minimal regions required for specific protein interactions

    • Particularly important for understanding the functional relationship with MYO5B and RAB11

  • Point mutations:

    • Target conserved residues in functional domains

    • Assess effects on protein binding and cellular function

    • Critical for distinguishing between direct and indirect interactions

Context-specific considerations:

  • For neuronal studies: Examine interactions in response to synaptic activity

  • For cancer research: Compare interaction networks in normal versus metastatic cells

  • For membrane trafficking: Analyze interactions under conditions that arrest specific trafficking steps

This comprehensive approach allows detailed characterization of the RAB11FIP2 interactome across different cellular contexts and physiological states.

What are effective strategies for studying RAB11FIP2's role in receptor trafficking and endosomal recycling?

RAB11FIP2's role in receptor trafficking can be investigated through several specialized approaches:

Live-cell imaging techniques:

  • Fluorescent fusion proteins:

    • Generate RAB11FIP2-GFP/RFP fusions with careful validation of functionality

    • Co-express with fluorescently-tagged receptors (e.g., EGFR-mCherry, GluA1-SEP)

    • Track vesicular movement using spinning disk or TIRF microscopy

    • Measure parameters like vesicle speed, directionality, and fusion events

  • pH-sensitive probes:

    • Utilize super-ecliptic pHluorin (SEP) tagged receptors

    • SEP fluorescence increases upon exposure to neutral pH at the cell surface

    • Allows quantitative measurement of receptor exocytosis and endocytosis rates

    • Particularly useful for studying AMPAR trafficking in neurons

Endosomal isolation and characterization:

  • Subcellular fractionation:

    • Separate endosomal compartments using density gradient centrifugation

    • Immunoblot fractions for RAB11FIP2, receptor proteins, and endosomal markers

    • Compare distribution patterns in control versus stimulated conditions

  • Immuno-isolation of vesicles:

    • Use magnetic beads coated with antibodies against RAB11FIP2 or Rab11

    • Isolate specific vesicle populations

    • Characterize composition by Western blotting or proteomics

Functional trafficking assays:

  • Receptor internalization/recycling assays:

    • Label surface receptors with cleavable biotin

    • Allow internalization for defined time periods

    • Measure internal/surface receptor ratio with/without RAB11FIP2 manipulation

    • Particularly useful for understanding EGFR trafficking in cancer cells

  • Transferrin recycling assay:

    • Use fluorescently-labeled transferrin to track the canonical recycling pathway

    • Measure uptake and recycling kinetics in cells with RAB11FIP2 knockdown/overexpression

    • Quantify by flow cytometry or microscopy

Genetic manipulation approaches:

  • Domain-specific mutants:

    • Target Rab11-binding domain (C2 domain)

    • Disrupt phospholipid binding (C2 domain)

    • Examine effects on receptor localization and trafficking

  • Acute protein depletion:

    • Use auxin-inducible degron (AID) system for rapid RAB11FIP2 depletion

    • Monitor immediate effects on receptor trafficking before compensatory mechanisms engage

These methodologies provide complementary insights into RAB11FIP2's multifaceted roles in receptor trafficking across different cellular contexts.

What approaches can resolve contradictory findings regarding RAB11FIP2's relationship with Rab11 versus independent functions?

The literature presents an apparent contradiction regarding RAB11FIP2's dependence on Rab11, with some studies showing it functions as a Rab11 effector while others indicate it can operate independently . Resolving this requires systematic investigation:

Molecular dissection strategies:

  • Interaction-deficient mutants:

    • Generate RAB11FIP2 variants that cannot bind Rab11 (mutations in the Rab-binding domain)

    • Assess which functions are preserved and which are lost

    • Compare phenotypes to complete RAB11FIP2 knockdown

  • Compartment-specific tethering:

    • Use chemical dimerization systems to artificially localize RAB11FIP2 to specific compartments

    • Determine which functions can be rescued independent of Rab11 localization

    • Particularly informative for AMPAR trafficking studies

Context-dependent analysis:

  • Cell-type comparative approach:

    • Systematically examine Rab11-dependency across different cell types

    • Compare neurons, epithelial cells, and immune cells

    • Identify cell-type specific factors that influence RAB11FIP2 function

  • Stimulus-dependent studies:

    • Compare basal versus stimulated conditions (e.g., LTP induction in neurons)

    • Test if Rab11-dependency changes during cellular activation

    • Examine differential phosphorylation under various conditions

Proximity analysis techniques:

  • High-resolution co-localization:

    • Use super-resolution microscopy (STED, STORM, etc.)

    • Quantify RAB11FIP2 and Rab11 co-localization with nanometer precision

    • Analyze in different subcellular compartments and physiological states

  • FRET/BRET analysis:

    • Generate FRET pairs of RAB11FIP2 and Rab11

    • Measure interaction dynamics in real-time during cellular processes

    • Identify conditions where association increases or decreases

Comprehensive protein interaction network analysis:

  • BioID/proximity labeling:

    • Compare RAB11FIP2 interaction networks in Rab11-depleted versus control cells

    • Identify Rab11-dependent and Rab11-independent interactors

    • Correlate with functional outcomes

  • Quantitative proteomics:

    • Analyze RAB11FIP2-associated proteins across various cellular conditions

    • Use SILAC or TMT labeling for quantitative comparison

    • Construct interaction networks that explain context-dependent functions

This systematic approach can reconcile conflicting findings by demonstrating that RAB11FIP2 likely has both Rab11-dependent and Rab11-independent functions that vary by cellular context, activation state, and subcellular compartment.

How should researchers interpret differential RAB11FIP2 expression patterns in disease models?

RAB11FIP2 expression changes have been implicated in several diseases, particularly gastric cancer . Proper interpretation requires systematic analysis:

Quantitative expression analysis methodology:

  • Tissue microarray (TMA) approach:

    • Analyze large cohorts of patient samples with standardized staining protocols

    • Use digital pathology for quantitative scoring of RAB11FIP2 immunoreactivity

    • Correlate with clinical parameters (tumor stage, nodal status, survival)

    • Critical for validating findings such as correlation with nodal metastasis in gastric cancer

  • Multi-level expression analysis:

    • Compare mRNA (qPCR, RNA-seq) and protein levels (Western blot, IHC)

    • Assess potential post-transcriptional regulation

    • Example data representation:

    Sample TypeRAB11FIP2 mRNA (fold change)RAB11FIP2 Protein (fold change)Clinical Correlation
    Normal Tissue1.0 (reference)1.0 (reference)N/A
    Primary Tumor2.3 ± 0.43.1 ± 0.6Tumor size (r=0.42)
    Metastatic Tissue4.7 ± 0.85.2 ± 0.9Nodal status (r=0.68)

Mechanistic interpretation guidelines:

  • Causation versus correlation:

    • Distinguish whether RAB11FIP2 changes drive disease progression or are secondary effects

    • Use genetic manipulation (knockdown/overexpression) in appropriate model systems

    • Assess direct functional outcomes (e.g., EMT markers, migration capacity)

  • Context-dependent effects:

    • Consider tissue microenvironment factors that may influence RAB11FIP2 function

    • Examine relationship with hypoxia and HIF-1α across different disease models

    • Compare effects in different cell types within the same tissue

Integrative data analysis framework:

  • Network-based interpretation:

    • Place RAB11FIP2 changes within broader signaling networks

    • Consider effects on key interaction partners (Rab11, MYO5B)

    • Validate through multiplex staining approaches

  • Multi-omics integration:

    • Correlate RAB11FIP2 expression changes with:

      • Transcriptomic profiles

      • Phosphoproteome alterations

      • Membrane protein trafficking patterns

    • Use pathway enrichment analysis to identify affected cellular processes

This comprehensive analytical framework allows researchers to move beyond simple correlative observations toward mechanistic understanding of RAB11FIP2's role in disease pathogenesis.

What statistical approaches are most appropriate for quantifying RAB11FIP2-mediated effects on receptor trafficking?

Quantitative analysis of RAB11FIP2's impact on receptor trafficking requires robust statistical methodologies:

Live-cell imaging quantification:

  • Vesicle tracking analysis:

    • Track individual vesicles containing fluorescently-tagged receptors

    • Measure parameters: velocity, displacement, directionality, fusion events

    • Appropriate statistical tests:

      • Nested ANOVA for comparing treatments with multiple cells per condition

      • Mixed-effects models to account for inter-cell variability

      • Kolmogorov-Smirnov test for comparing distributions of vesicle velocities

  • Receptor surface expression dynamics:

    • For pH-sensitive probes (SEP-tagged receptors):

      • Calculate rate constants for exocytosis and endocytosis

      • Use regression analysis for rate determination

      • Apply bootstrapping for confidence interval estimation

Sample size and power considerations:

  • Minimum detection thresholds:

    • For detecting 20% change in trafficking parameters with 80% power:

      • Cell imaging: 20-30 cells per condition across 3+ independent experiments

      • Biochemical assays: 4-6 biological replicates

    • Adjust based on effect size and variability in preliminary data

  • Hierarchical sampling design:

    • Account for nested experimental structure:

      • Multiple measurements per cell

      • Multiple cells per culture

      • Multiple cultures per experiment

    • Use hierarchical/mixed models to properly assign variance components

Advanced analytical approaches:

  • Machine learning classification:

    • Train algorithms to categorize trafficking patterns

    • Features may include vesicle morphology, movement characteristics, and fusion kinetics

    • Particularly valuable for detecting subtle phenotypes in RAB11FIP2 mutants

  • Spatial statistics:

    • Ripley's K-function for analyzing clustering of RAB11FIP2-positive vesicles

    • Nearest neighbor analysis for quantifying colocalization with receptors

    • Manders' or Pearson's coefficients with statistical testing for colocalization significance

Experimental design for robust statistical inference:

  • Blinded analysis protocols:

    • Anonymize experimental conditions during image analysis

    • Use automated analysis pipelines when possible

    • Have multiple independent analysts quantify subset of data to ensure reproducibility

  • Positive and negative controls:

    • Include known trafficking modulators as positive controls

    • Use scrambled siRNA or inactive mutants as negative controls

    • Calculate Z-factor to assess assay robustness

This comprehensive statistical framework ensures reliable quantification of RAB11FIP2's effects on receptor trafficking while appropriately accounting for biological and technical variability.

How can researchers integrate findings from multiple experimental systems to build a comprehensive model of RAB11FIP2 function?

Building a unified model of RAB11FIP2 function requires systematic integration of data from diverse experimental approaches:

Cross-system validation framework:

  • Multi-level experimental alignment:

    • Compare findings across in vitro, cellular, and in vivo systems

    • Create correspondence tables mapping molecular events to cellular/physiological outcomes

    • Example integration table:

    Molecular FindingCellular PhenotypePhysiological/Disease Relevance
    RAB11FIP2 phosphorylationAltered AMPAR traffickingModified synaptic plasticity/learning
    RAB11FIP2-actin interactionCytoskeletal reorganizationEnhanced cell motility/cancer metastasis
    RAB11FIP2-HIF-1α regulationResponse to hypoxiaTumor microenvironment adaptation
  • Temporal scale integration:

    • Align acute versus chronic effects of RAB11FIP2 manipulation

    • Map molecular events (seconds-minutes) to cellular responses (minutes-hours) to physiological outcomes (hours-days)

Computational modeling approaches:

  • Network-based modeling:

    • Construct protein-protein interaction networks centered on RAB11FIP2

    • Apply Boolean or Bayesian network analysis to predict system behavior

    • Validate model predictions with targeted experiments

    • Particularly valuable for understanding RAB11FIP2's dual roles in receptor trafficking and cytoskeletal regulation

  • Agent-based modeling:

    • Simulate individual vesicles, receptors, and cytoskeletal elements

    • Incorporate RAB11FIP2 regulatory mechanisms

    • Test hypotheses about emergent cellular behaviors

    • Useful for reconciling seemingly contradictory experimental observations

Interdisciplinary data synthesis:

  • Structural-functional correlation:

    • Integrate structural insights (domains, binding interfaces) with cellular phenotypes

    • Map phosphorylation sites to functional outcomes

    • Create domain-function relationship maps

  • Multi-omics integration:

    • Correlate transcriptomic, proteomic, and phosphoproteomic data

    • Identify regulatory networks governing RAB11FIP2 expression and function

    • Apply pathway enrichment and gene set enrichment analysis (GSEA)

Translational perspective integration:

  • Disease-specific contextualization:

    • Compare RAB11FIP2 functions across different pathological contexts

    • Identify common versus disease-specific mechanisms

    • Example: Contrast roles in cancer metastasis versus neuronal plasticity

  • Therapeutic targeting framework:

    • Identify context-dependent vulnerabilities in RAB11FIP2 function

    • Map druggable nodes in associated pathways

    • Predict potential on-target and off-target effects of RAB11FIP2 modulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.