RAD54B Antibody

What epitopes of RAD54B are commonly targeted by research antibodies?

RAD54B antibodies typically target several key regions of the 910 amino acid protein. Common target regions include:

• N-terminal region (AA 1-167 or AA 1-158): Important for interaction studies as this region may be involved in protein-protein interactions

• Middle region (containing the sequence NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT): Useful for detecting the functional domains of RAD54B

• C-terminal region (AA 801-910): Valuable for studying the complete protein

The choice of epitope can significantly impact experimental outcomes. N-terminal antibodies may be better suited for studying protein interactions, while antibodies against conserved domains within the central helicase region may offer broader cross-reactivity across species .

How do polyclonal and monoclonal RAD54B antibodies compare in research applications?

Both polyclonal and monoclonal antibodies have specific advantages in RAD54B research:

Polyclonal RAD54B antibodies:

• Recognize multiple epitopes, providing stronger signals in applications like western blotting and IHC

• Show higher sensitivity for detecting native proteins

• Examples include rabbit polyclonal antibodies targeting the middle or N-terminal regions

• Generally more tolerant of minor protein denaturation or fixation

Monoclonal RAD54B antibodies:

• Offer higher specificity and reproducibility between experiments

• Produce less background in immunofluorescence applications

• Examples include mouse monoclonal antibodies like 19-K2 that detect RAD54B with high specificity

• Particularly valuable for co-localization studies with other DNA repair proteins

For studying RAD54B's interaction with other proteins (like S100A11 in DNA repair complexes), monoclonal antibodies often provide cleaner results in co-immunoprecipitation experiments .

What validation methods should be employed to confirm RAD54B antibody specificity?

Thorough validation of RAD54B antibodies is crucial for reliable research. Recommended validation approaches include:

• Western blot analysis: Confirming single band detection at ~103 kDa (RAD54B's expected molecular weight)

• Positive and negative controls: Using cell lines with known RAD54B expression levels (high in testis and spleen tissues) versus RAD54B-knockout or knockdown models

• Peptide competition assays: Pre-incubating the antibody with the immunizing peptide should abolish specific signals

• Cross-validation with multiple antibodies: Using antibodies against different RAD54B epitopes to confirm findings

• Immunoprecipitation followed by mass spectrometry: To confirm the identity of the precipitated protein as RAD54B

As reported by Wesoly et al., antibody specificity can be further validated through immunofluorescence co-localization studies with other DNA repair factors like γH2AX at DNA damage sites .

What are optimal protocols for detecting RAD54B in DNA damage response studies?

When studying RAD54B's role in DNA damage response, consider these optimized protocols:

For immunofluorescence detection of RAD54B at DNA repair foci:

• Induce DNA double-strand breaks using agents like bleomycin (which showed increased RAD54B/S100A11 colocalization)

• Fix cells using 4% paraformaldehyde (10 minutes at room temperature)

• Permeabilize with 0.5% Triton X-100

• Block with 3% BSA in PBS

• Use anti-RAD54B antibody at 1:200-1:500 dilution

• Co-stain with DNA damage markers like γH2AX to confirm localization at repair sites

• Include counterstains for other repair factors (Rad51, PCNA, Ku80) to study complex formation

For western blot detection after DNA damage:

• Prepare cell lysates in RIPA buffer supplemented with phosphatase inhibitors

• Load 50-75 μg of total protein per lane

• Use 7.5% SDS-PAGE gels to properly resolve the ~103 kDa RAD54B protein

• Transfer to PVDF membranes at 30V overnight at 4°C for efficient transfer of large proteins

• Block with 5% non-fat dry milk in TBST

• Incubate with primary anti-RAD54B antibody (1:1000)

• Detect using HRP-conjugated secondary antibodies and enhanced chemiluminescence

These protocols have been effectively used to demonstrate RAD54B recruitment to DNA damage sites and its interaction with other repair factors .

How can co-immunoprecipitation experiments be optimized to study RAD54B protein interactions?

Based on successful studies of RAD54B interactions with S100A11 and other proteins, the following optimized co-IP protocol is recommended:

• Cell lysis:

  • Lyse cells in buffer containing 20 mM HEPES/KOH (pH 8.0), 50 mM KCl, 0.1 mM EDTA, and 0.05% CHAPS

  • Include protease and phosphatase inhibitor cocktails

  • Perform on ice for 30 minutes with occasional gentle mixing

• Antibody coupling:

  • Bind 2-5 μg of anti-RAD54B antibody to protein A-agarose beads

  • Alternative approach: Use Interaction Discovery Mapping (IDM) beads incubated with protein A overnight at 4°C, followed by antibody binding in 50 mM sodium acetate (pH 5.0)

• Immunoprecipitation:

  • Incubate crude extract (100 μl) with antibody-coupled beads for 1-2 hours at 4°C

  • Wash three times with co-IP buffer

  • Elute bound proteins with SDS sample buffer or gentle elution buffer for maintaining protein complexes

• Detection:

  • Analyze by western blotting using antibodies against suspected interaction partners

  • Consider mass spectrometry for unbiased identification of novel interactors

This approach successfully identified RAD54B's interaction with S100A11 and showed how this interaction increased following DNA damage induction .

What controls are essential when using RAD54B antibodies in immunofluorescence studies?

When performing immunofluorescence with RAD54B antibodies, include these essential controls:

• Positive control: Cell lines with known high RAD54B expression (testis-derived or spleen-derived cell lines)

• Negative controls:

  • Primary antibody omission

  • Non-specific IgG of the same species and concentration

  • RAD54B-knockdown cells (siRNA or shRNA treated)

• Specificity controls:

  • Peptide competition (pre-incubation of antibody with immunizing peptide)

  • Secondary antibody-only control

• Functional validation controls:

  • Untreated versus DNA damage-induced cells (RAD54B forms discrete nuclear foci after damage)

  • Co-staining with established DNA repair markers:

    • γH2AX (marker of DNA double-strand breaks)

    • Rad51 (homologous recombination protein)

    • PCNA (replication fork marker)

    • SC-35 (nuclear speckle marker for contrast)

In triple-color immunofluorescence experiments, careful selection of fluorophores with minimal spectral overlap is crucial (fluorescein, Cy3, and Cy5 combinations have been successfully used) .

How can RAD54B antibodies be used to investigate the relationship between RAD54B and cancer progression?

RAD54B has been implicated in various cancers, and antibodies can be powerful tools for investigating its role:

Immunohistochemistry approach for patient samples:

• Use paraffin-embedded tissue microarrays containing tumor and matched normal tissues

• Score RAD54B expression levels (low/medium/high) based on staining intensity

• Correlate with clinical parameters and survival data

• This approach revealed RAD54B overexpression correlates with poor prognosis in hepatocellular carcinoma (HCC)

Molecular mechanism studies:

A study by Wang et al. demonstrated that RAD54B knockdown inhibited proliferation and enhanced apoptosis in hepatoma cells, suggesting its potential as a therapeutic target .

What microscopy techniques can be paired with RAD54B antibodies to study DNA repair dynamics?

Advanced microscopy techniques combined with RAD54B antibodies enable detailed analysis of DNA repair processes:

Live-cell imaging:

• Combine RAD54B antibody fragments (Fab) conjugated to quantum dots or fluorescent proteins

• Track recruitment kinetics to laser-induced DNA damage sites

• Measure residence time and turnover rates of RAD54B at repair foci

Super-resolution microscopy:

• STORM or PALM imaging of RAD54B with 10-20nm resolution

• Reveals spatial organization of RAD54B within repair complexes

• Can be combined with other repair factors to build 3D models of repair centers

FRAP (Fluorescence Recovery After Photobleaching):

• Study dynamics of RAD54B recruitment to and dissociation from repair sites

• Determine mobile versus immobile fractions of RAD54B protein

• Compare kinetics between normal and cancer cells

Proximity ligation assay (PLA):

• Detect direct protein-protein interactions between RAD54B and other factors

• Successful application showed RAD54B interaction with S100A11 increased after DNA damage

• Can be quantified to measure interaction frequencies under different conditions

These techniques have revealed that RAD54B and S100A11 foci are spatially associated with sites of DNA double-strand break repair, and their colocalization increases following treatment with DNA-damaging agents like bleomycin .

How can RAD54B antibodies help investigate checkpoint regulation in cancer cells?

RAD54B has been identified as a critical regulator of cell cycle checkpoints. Antibodies can help investigate this function through:

Checkpoint strength analysis:

• Use anti-RAD54B antibodies to measure protein levels before and after DNA damage

• Correlate with checkpoint activation markers (phospho-CHK1, phospho-CHK2, p53)

• Track changes in RAD54B levels during different cell cycle phases

RAD54B's scaffolding function:

• Study showed RAD54B functions as a scaffold for p53 degradation via direct interaction with the MDM2-MDMX ubiquitin-ligase complex

• Use RAD54B antibodies in combination with anti-MDM2 and anti-MDMX antibodies to:

  • Detect complex formation by co-immunoprecipitation

  • Visualize co-localization patterns by immunofluorescence

  • Monitor changes in complex formation after DNA damage

Cell cycle regulation:

• Studies revealed RAD54B is upregulated during early phases of DDR, maintaining low checkpoint strength

• As p53-mediated checkpoint is established, RAD54B is downregulated

• This dynamic regulation can be monitored using RAD54B antibodies in combination with cell cycle markers

Notably, constitutive upregulation of RAD54B, frequently observed in tumors, promotes genomic instability by allowing checkpoint override. This makes RAD54B an important target for cancer research and potential therapeutic development .

What are common challenges when using RAD54B antibodies in immunohistochemistry?

Researchers frequently encounter these challenges when using RAD54B antibodies for IHC:

Challenge: Weak or absent staining

• Possible causes:

  • Epitope masking during fixation

  • Protein degradation

  • Low RAD54B expression

• Solutions:

  • Try antigen retrieval methods (citrate buffer pH 6.0 or EDTA buffer pH 9.0)

  • Use fresh tissue samples and optimize fixation time

  • Try antibodies targeting different RAD54B epitopes

  • Increase antibody concentration or incubation time

Challenge: High background staining

• Possible causes:

  • Non-specific binding

  • Excessive antibody concentration

  • Inadequate blocking

• Solutions:

  • Increase blocking time (3-5% BSA or 10% normal serum)

  • Optimize antibody dilution (typically 1:100-1:500 for RAD54B antibodies)

  • Include 0.1-0.3% Triton X-100 in blocking solution

  • Use monoclonal antibodies like 19-K2 which offer higher specificity

Challenge: Inconsistent results between experiments

• Possible causes:

  • Variability in tissue processing

  • Antibody degradation

  • Differences in expression levels

• Solutions:

  • Standardize tissue processing protocols

  • Aliquot antibodies to avoid freeze-thaw cycles

  • Include positive control tissues (testis/spleen show high RAD54B expression)

  • Use automated IHC systems when available

A systematic approach of testing multiple antibody dilutions, antigen retrieval methods, and incubation times can help optimize RAD54B detection in IHC applications.

How should results be interpreted when RAD54B antibody detection doesn't correlate with mRNA expression?

Discrepancies between RAD54B protein levels (detected by antibodies) and mRNA expression require careful interpretation:

Possible explanations for discrepancies:

• Post-transcriptional regulation:

  • RAD54B protein may be subject to regulation by microRNAs

  • Assess stability of RAD54B protein (half-life) using cycloheximide chase experiments

  • Check for presence of regulatory elements in RAD54B mRNA 3'UTR

• Post-translational modifications:

  • Phosphorylation, ubiquitination may affect antibody recognition

  • Try antibodies recognizing different epitopes

  • Use phospho-specific or modification-specific antibodies if available

• Protein localization changes:

  • RAD54B may relocalize to insoluble fractions after DNA damage

  • Extract proteins using different lysis conditions (RIPA vs. stronger detergents)

  • Compare nuclear vs. cytoplasmic fractions

• Technical considerations:

  • Evaluate antibody specificity using knockdown controls

  • Check primer specificity for RAD54B mRNA detection

  • Consider presence of RAD54B splice variants

In one study, RAD54B mRNA was significantly upregulated in HCC tissues compared to normal liver tissues, and this correlated with protein levels detected using validated antibodies. The researchers validated their findings using multiple methodologies (qPCR, western blotting, and IHC) to ensure consistency .

What approaches can resolve cross-reactivity issues with RAD54B antibodies?

Cross-reactivity can complicate RAD54B detection, especially with closely related proteins like RAD54. These approaches can help:

Antibody validation strategies:

• Test antibodies on RAD54B knockout or knockdown samples

• Perform peptide competition assays with the immunizing peptide

• Compare multiple antibodies targeting different RAD54B epitopes

• Perform western blots on both RAD54 and RAD54B recombinant proteins to confirm specificity

Experimental optimizations:

• Increase antibody dilution to reduce non-specific binding

• Use more stringent washing conditions (higher salt concentration)

• Pre-adsorb antibodies with cell lysates from RAD54B-knockout cells

• Use monoclonal antibodies when absolute specificity is required

Alternative detection strategies:

• Use epitope-tagged RAD54B for overexpression studies

• Consider proximity ligation assays which require two antibodies for signal generation

• Employ mass spectrometry to confirm antibody targets in immunoprecipitated samples

Research has shown that commercial antibodies targeting the middle region of RAD54B (e.g., ABIN2775216) provide good specificity across multiple species, while the 19-K2 monoclonal antibody offers high specificity for human RAD54B .

How are RAD54B antibodies being used to identify potential cancer biomarkers?

RAD54B is emerging as a potential cancer biomarker, with antibodies playing a crucial role in this research:

Prognostic biomarker development:

• IHC staining of tissue microarrays from cancer patients using RAD54B antibodies

• Correlation of expression levels with clinical outcomes

• In HCC studies, RAD54B overexpression correlated with shorter survival times, suggesting its value as a prognostic marker

• Similar findings in breast cancer showed RAD54B could be incorporated into a prognostic signature

Functional biomarker studies:

• Using RAD54B antibodies to study its checkpoint regulation function

• Constitutive upregulation of RAD54B promotes genomic instability due to checkpoint override

• This makes RAD54B status a potential biomarker for genomic instability in tumors

Multi-marker panels:

Therapeutic target identification:

• RAD54B antibodies help identify cancer-specific dependencies

• One study identified Japonicone A from the herb Inula japonica Thunb as a compound that decreased breast cancer cell proliferation by inhibiting RAD54B expression

These approaches demonstrate how RAD54B antibodies contribute to both diagnostic and therapeutic advances in cancer research.

What new techniques are emerging for studying RAD54B's role in genome stability maintenance?

Cutting-edge techniques utilizing RAD54B antibodies are advancing our understanding of genome stability:

CRISPR-Cas9 screens combined with RAD54B immunoprofiling:

• Perform genome-wide CRISPR screens for genes affecting RAD54B function

• Use RAD54B antibodies to assess changes in localization, expression, or post-translational modifications

• Identify synthetic lethal interactions with RAD54B in cancer contexts

Single-molecule imaging:

• Track individual RAD54B molecules at DNA damage sites

• Combine with super-resolution microscopy to visualize repair complex assembly

• Measure RAD54B's DNA-dependent ATPase activity in situ

Chromatin immunoprecipitation sequencing (ChIP-seq):

• Map genome-wide binding sites of RAD54B using specific antibodies

• Identify preferential binding at specific genomic features

• Compare binding patterns before and after DNA damage

Proximity-dependent labeling:

• Use BioID or APEX2 fused to RAD54B

• Identify proteins in close proximity to RAD54B during DNA repair

• Validate interactions using co-immunoprecipitation with RAD54B antibodies

Previous research demonstrated RAD54B's interaction with S100A11 and their colocalization at DNA repair sites . New techniques will further elucidate how RAD54B's DNA-dependent ATPase activity and its scaffolding function in checkpoint regulation contribute to genome stability maintenance.

How can RAD54B antibodies contribute to developing targeted cancer therapies?

RAD54B is emerging as a promising therapeutic target, with antibodies facilitating several key research approaches:

Target validation studies:

• Use RAD54B antibodies to confirm expression in target cancer types

• Immunohistochemistry of patient samples shows RAD54B overexpression in multiple cancers:

  • Hepatocellular carcinoma

  • Breast cancer

  • Lymphoma and colon cancer

Mechanism of action studies:

• RAD54B antibodies help elucidate pathways amenable to therapeutic intervention:

  • RAD54B's scaffolding function in p53 degradation via MDM2-MDMX complex

  • RAD54B's role in the Wnt/β-catenin pathway in HCC progression

  • RAD54B's function in DNA double-strand break repair

Therapeutic compound screening:

• Develop high-throughput immunoassays using RAD54B antibodies to:

  • Screen compounds that modulate RAD54B expression, localization, or function

  • Identify compounds that disrupt RAD54B interactions with partner proteins

  • A study identified Japonicone A as a compound that inhibits RAD54B expression in breast cancer cells

Combination therapy approaches:

• Use RAD54B antibodies to study synthetic lethality with other DNA repair inhibitors

• RAD54B knockdown studies showed increased apoptosis in cancer cells, suggesting potential therapeutic vulnerabilities

These applications highlight how RAD54B antibodies serve as critical tools in the translation from basic research to clinical applications, potentially leading to novel targeted therapies for cancers with RAD54B dysregulation.