RANBP17 Antibody

Shipped with Ice Packs
In Stock

Product Specs

Buffer
The antibody is provided in a liquid solution containing phosphate-buffered saline (PBS), 50% glycerol, 0.5% bovine serum albumin (BSA), and 0.02% sodium azide.
Form
Liquid
Lead Time
Typically, we can ship the products within 1-3 business days following order receipt. The delivery timeframe may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Synonyms
FLJ32916 antibody; RAN binding protein 17 antibody; Ran-binding protein 17 antibody; RanBP 17 antibody; Ranbp17 antibody; RBP17_HUMAN antibody
Target Names
RANBP17
Uniprot No.

Target Background

Function
RANBP17 Antibody may function as a nuclear transport receptor.
Database Links

HGNC: 14428

OMIM: 606141

KEGG: hsa:64901

STRING: 9606.ENSP00000427975

UniGene: Hs.410810

Protein Families
Exportin family
Subcellular Location
Cytoplasm. Nucleus. Nucleus, nuclear pore complex.
Tissue Specificity
Highly expressed in testis, moderately in pancreas and weakly in other tissues studied.

Q&A

What is RANBP17 and what cellular functions does it regulate?

RANBP17 (RAN binding protein 17) is a member of the importin beta superfamily of nuclear transport receptors, consisting of 1,088 amino acids with a mass of approximately 124.4 kDa . It functions as a crucial component in the nucleocytoplasmic transport (NCT) system, primarily facilitating the import of proteins with nuclear localization signals (NLS) through nuclear pore complexes (NPCs) .

Recent research has revealed that RANBP17 plays significant roles in:

  • Nuclear transport of both protein and transcript cargos in human neurons

  • Cell proliferation in head and neck squamous cell carcinoma (HNSCC) and other epithelial cells

  • Neurodevelopment, with particular relevance to DYT1 dystonia

The protein contains an N-terminal importin β domain (amino acids 30-95) within a larger region that shares homology with the CRM1 nuclear export protein (amino acids 8-167) .

What are the optimal applications for RANBP17 antibodies in experimental settings?

RANBP17 antibodies have been validated for multiple experimental applications:

ApplicationCommon DilutionsNotes
Western Blot (WB)1:500 - 1:3000 Most widely used application
ELISA1:20000 Frequently used for quantitative analysis
Immunofluorescence (IF)0.25-2 μg/mL Useful for subcellular localization studies
Immunoprecipitation (IP)Varies by antibodyFor protein-protein interaction studies
Immunocytochemistry (ICC)Varies by antibodyFor cellular localization studies

When selecting an antibody, researchers should consider:

  • The epitope recognized (N-terminal, C-terminal, or full-length protein)

  • Host species (rabbit and mouse are common for RANBP17 antibodies)

  • Clonality (monoclonal for specificity or polyclonal for broader detection)

  • Validated applications specific to each antibody product

How can I validate the specificity of a RANBP17 antibody for my research?

Proper validation of RANBP17 antibodies is critical due to potential issues with specificity and reported discrepancies between RNA and protein expression levels . A comprehensive validation approach should include:

  • Positive and negative controls:

    • Use tissues known to express RANBP17 (testis shows high expression, pancreas moderate)

    • Include knockout/knockdown samples when possible (RNAi knockdown has been used)

  • Blocking peptide validation:

    • Utilize specific blocking peptides (e.g., APrEST73986 has been used to validate HPA029568)

  • Multiple detection methods:

    • Compare results across different techniques (WB, IF, IHC)

    • Verify that band size matches expected molecular weight (124.4 kDa)

  • Consider RNA-protein discrepancy:

    • Be aware that researchers have noted "major discrepancy between RanBP17 RNA and protein expression levels"

    • This may be due to additional splice isoforms or circular RNA species

What is the tissue distribution pattern of RANBP17 and how does this inform experimental design?

RANBP17 exhibits a distinctive tissue expression pattern that should inform experimental design:

High expression:

  • Testis (most prominent expression)

Moderate expression:

Low/variable expression:

  • Heart, placenta, lung, liver

  • Thyroid, spinal cord, trachea, adrenal gland

  • Various cell lines: erythroid HEL, megakaryocyte cell lines Meg01 and M07E

When designing experiments:

  • Include testis tissue as a positive control when possible

  • Expect weaker signals in other tissues, which may require optimized detection methods

  • Consider that RANBP17 localizes to both nucleus and cytoplasm, with particular association to nuclear pore complexes

  • Be aware that subcellular localization studies have shown RANBP17 colocalizing with SC35 domains (nuclear speckles) and other nuclear bodies distinct from nucleoli

How does RANBP17 contribute to nucleocytoplasmic transport and what experimental approaches can assess this function?

RANBP17's role in nucleocytoplasmic transport (NCT) can be studied through several experimental approaches:

Mechanism of action:
RANBP17 facilitates transport of both protein and transcript cargos through nuclear pore complexes by interacting with:

  • Nucleoporins

  • GTP-bound form of Ran

  • Various cargo proteins with nuclear localization signals

Experimental approaches to assess NCT function:

  • Reporter assays:

    • GFP-NLS/GFP-NES and RFP-NLS/RFP-NES constructs to track nuclear import/export

    • These fluorescent reporters coupled with nuclear export signals (NES) or nuclear localization signals (NLS) allow visualization of transport dynamics

  • Manipulation of RANBP17 expression:

    • Knockdown with shRNAs (e.g., RANBP17-shRNAs)

    • Overexpression using lentiviral vectors (e.g., GFP-tagged RANBP17)

  • Cargo identification:

    • Immunoprecipitation coupled with mass spectrometry to identify transported proteins

    • RNA immunoprecipitation to identify transported transcripts

  • Functional rescue experiments:

    • Particularly valuable in disease models like DYT1 dystonia, where RANBP17 overexpression restores impaired NCT

What are the known interaction partners of RANBP17 and their functional significance?

RANBP17 interacts with several proteins that provide insight into its various cellular functions:

Interaction PartnerDetection MethodFunctional Significance
E2A proteins (E12/E47)Yeast two-hybrid, immunoprecipitationEnhances E2A/MyoD-mediated transactivation of E-box regulated genes
SPEM1Yeast two-hybrid, immunoprecipitationInteraction on the manchette of elongating spermatids
RanGTPAffinity chromatographyCritical for nucleocytoplasmic transport function
NucleoporinsImplied by functionRequired components of nuclear transport pathway
SC35 domainsImmunofluorescence colocalizationAssociation with nuclear speckles suggests role in RNA processing

Functional consequences of these interactions include:

  • Increased transcription of E2A target genes, such as p21Waf1/Cip1

  • Potential roles in spermatogenesis through SPEM1 interaction

  • Enhanced nuclear transport activity for both proteins and transcripts

Experimental approaches to study these interactions include co-immunoprecipitation, proximity ligation assays, and fluorescence resonance energy transfer (FRET).

How does RANBP17 expression correlate with clinical outcomes in different cancers?

Research has revealed significant correlations between RANBP17 expression and clinical outcomes in certain cancers, particularly head and neck squamous cell carcinoma (HNSCC):

HPV-positive HNSCC:

  • TCGA database analysis showed strong positive correlation between RANBP17 RNA expression and patient survival

  • Association with CDKN2A expression specifically in HPV-positive HNSCC

  • This suggests RANBP17 could potentially serve as a prognostic marker for HPV-positive HNSCC patients

Experimental evidence on cell proliferation:

  • RNAi knockdown of RANBP17 significantly reduced cell proliferation in HNSCC cell lines

  • Similar effects observed in unrelated cell lines (HCT116 from colon cancer and MDA-MB-231 from breast cancer)

  • Treatment with cisplatin (which inhibits cell proliferation) reduced RANBP17 in keratinocytes but induced it in tumor cell lines

  • EGFR kinase inhibitor AG1478 induced RANBP17 expression in tumor cell lines

These findings suggest that RANBP17's role in cancer may be context-dependent, with different functions in HPV-positive versus HPV-negative tumors, and in normal versus cancerous cells.

What are the technical challenges in detecting RANBP17 protein versus RNA, and how can they be addressed?

Researchers have reported significant discrepancies between RANBP17 RNA and protein expression levels , presenting specific technical challenges:

Observed discrepancies:

  • Despite detectable RNA levels, protein detection can be problematic with available antibodies

  • This may be due to:

    • Alternative splice isoforms not recognized by standard antibodies

    • Presence of non-coding circular RANBP17 RNA species

    • Post-transcriptional regulation affecting translation efficiency

Addressing these challenges:

ChallengeSolution Strategy
Splice variant detectionUse antibodies targeting different epitopes; validate with recombinant protein standards
Distinguishing protein isoformsWestern blot with gradient gels to resolve closely sized proteins
Circular RNA detectionSpecialized RNA isolation and RNase R treatment to enrich for circular RNA
Low protein expressionEnhanced detection methods (e.g., chemiluminescence substrates with higher sensitivity)
Antibody specificityValidate with blocking peptides, siRNA knockdown controls, and orthogonal detection methods

Recommended experimental approach:

  • Combine RNA analysis (qPCR, RNA-seq) with protein detection (Western blot, immunoprecipitation)

  • Validate antibody specificity using blocking peptides (e.g., APrEST73986 for HPA029568)

  • Consider enrichment strategies for low-abundance proteins

  • Check for alternative transcripts using RNA-seq analysis with appropriate algorithms for circular RNA detection

How does overexpression of RANBP17 rescue neurodevelopmental deficits in DYT1 dystonia models?

Recent breakthrough research has demonstrated that RANBP17 overexpression can effectively restore impaired nucleocytoplasmic transport (NCT) and rescue neurodevelopmental deficits in DYT1 dystonia models :

Key experimental findings:

  • Transcriptomic analysis revealed significantly decreased RANBP17 expression in DYT1 motor neurons (MNs) compared to healthy controls

  • RANBP17 was shown to facilitate nuclear transport of both protein and transcript cargos in human neurons

  • Overexpression of RANBP17 successfully:

    • Restored impaired NCT activity

    • Rescued neurodevelopmental deficits observed in DYT1 MNs

Experimental system:

  • Human-induced pluripotent stem cells (hiPSCs) derived from DYT1 dystonia patients

  • Differentiation into motor neurons (MNs) to create disease-relevant cellular models

  • Lentiviral vectors used for RANBP17 overexpression

Rescue mechanisms:

  • NCT restoration: RANBP17 overexpression corrects the defective nuclear transport of proteins containing nuclear localization signals (NLS) and nuclear export signals (NES)

  • Neurodevelopmental rescue: Improved NCT leads to proper neurodevelopment, addressing the underlying cellular deficits in DYT1 dystonia

This research provides valuable insights into DYT1 dystonia pathophysiology and identifies RANBP17 as a potential therapeutic target for innovative treatment strategies .

What experimental design is optimal for studying RANBP17's molecular function in nuclear transport?

A comprehensive experimental design to study RANBP17's molecular function in nuclear transport should integrate multiple approaches:

Cargo identification and trafficking analysis:

  • Fluorescent reporter assays using:

    • GFP-NLS/GFP-NES constructs for protein cargo tracking

    • RNA labeling techniques (MS2 system) for transcript cargo visualization

  • Live-cell imaging to monitor transport kinetics

  • FRAP (Fluorescence Recovery After Photobleaching) to measure transport rates

Structure-function analysis:

  • Generate domain-specific mutants and truncations of RANBP17

  • Key domains to target include:

    • N-terminal importin β domain (amino acids 30-95)

    • CRM1 homology region (amino acids 8-167)

  • Compare function to related proteins (RANBP16/XPO7) which share 66% amino acid identity

Interaction mapping:

  • Proximity-based labeling (BioID or APEX) to identify the nuclear transport interactome

  • Co-immunoprecipitation combined with mass spectrometry

  • In vitro binding assays with purified components

  • Yeast two-hybrid screening for novel interaction partners

Disease model application:

  • DYT1 dystonia models using patient-derived iPSCs differentiated to neurons

  • Rescue experiments with wild-type and mutant RANBP17 constructs

  • Comparison with other interventions targeting NCT

Quantitative assessments:

  • Develop high-throughput assays to measure nuclear import/export rates

  • Establish standardized readouts for NCT function rescue

  • Correlate RANBP17 expression levels with quantitative transport metrics

This multi-faceted approach would provide comprehensive insights into RANBP17's specific role in nucleocytoplasmic transport and its potential as a therapeutic target for diseases involving NCT dysfunction.

What are the key considerations for selecting the appropriate RANBP17 antibody for specific research applications?

When selecting a RANBP17 antibody for specific research applications, consider these critical factors:

Selection FactorConsiderations
Epitope location- N-terminal antibodies may detect different isoforms than C-terminal ones
- HPA029568 recognizes an N-terminal epitope (MDGELSCRVFQLISLMDTGLPRCCNEKIELAILWFLDQFRKTYVGDQLQRTSKVYARMSEVLGITDDNHVLETFMT)
- Consider multiple antibodies targeting different regions for comprehensive detection
Clonality- Monoclonal antibodies (e.g., B-1 clone ) offer high specificity for a single epitope
- Polyclonal antibodies can recognize multiple epitopes, potentially increasing detection sensitivity
Validated applications- Ensure the antibody is validated for your specific application (WB, IF, IHC, IP, ELISA)
- Review published validation data from manufacturers and literature
Host species- Consider compatibility with other antibodies for co-staining experiments
- Rabbit and mouse are common hosts for RANBP17 antibodies
Conjugation options- Available conjugates include HRP, PE, FITC, and various Alexa Fluor dyes
- Select based on detection method and multiplexing requirements

Application-specific recommendations:

  • For Western blotting: Select antibodies with demonstrated specificity at the expected molecular weight (124.4 kDa)

  • For immunofluorescence: Choose antibodies validated for subcellular localization studies, particularly those with nuclear/cytoplasmic distribution patterns

  • For immunoprecipitation: Select antibodies with high affinity that maintain native protein interactions

Always validate antibody performance in your specific experimental system, as discrepancies between RNA and protein detection have been reported .

How can researchers optimize protocols for detecting low-abundance RANBP17 in different tissue types?

Detection of RANBP17 can be challenging due to its variable expression across tissues and reported discrepancies between RNA and protein levels . Optimize protocols with these strategies:

Western Blot optimization:

  • Increase protein loading (50-100 μg total protein for low-expressing tissues)

  • Use PVDF membranes (higher protein binding capacity than nitrocellulose)

  • Employ signal enhancement systems (e.g., HRP-conjugated polymers)

  • Extend primary antibody incubation (overnight at 4°C)

  • Consider membrane stripping and reprobing with different RANBP17 antibodies targeting distinct epitopes

Immunofluorescence/Immunohistochemistry enhancement:

  • Incorporate antigen retrieval methods (heat-induced or enzymatic)

  • Use tyramide signal amplification (TSA) systems

  • Increase antibody concentration for low-expressing tissues

  • Optimize fixation protocols (e.g., 4% paraformaldehyde for 10-15 minutes)

  • Use confocal microscopy for improved signal-to-noise ratio

RNA detection strategies:

  • Implement RNAscope for sensitive in situ hybridization

  • Use qPCR with probe-based detection for improved sensitivity

  • Consider digital PCR for absolute quantification of low-abundance transcripts

Enrichment approaches:

  • For nuclear transport studies, isolate nuclear and cytoplasmic fractions separately

  • Use immunoprecipitation to concentrate RANBP17 before detection

  • Consider proximity ligation assay (PLA) to visualize protein-protein interactions with higher sensitivity

Tissue-specific considerations:

  • For non-testis tissues with lower expression, adapt protocols to account for reduced signal

  • Include positive controls (testis extracts) alongside experimental samples

  • Consider background reduction strategies specific to each tissue type

Validation should always include appropriate controls, including RNAi knockdown samples when possible .

What are the optimal experimental models for studying RANBP17's role in DYT1 dystonia?

Recent breakthrough studies on RANBP17's role in DYT1 dystonia have established several effective experimental models :

iPSC-derived neuronal models:

  • Patient-derived iPSCs: Generate induced pluripotent stem cells from DYT1 dystonia patients carrying the characteristic TOR1A gene mutation

  • Isogenic controls: Create gene-corrected lines via CRISPR/Cas9 editing to provide matched controls

  • Differentiation protocols: Direct differentiation into motor neurons (MNs), which exhibit disease-relevant phenotypes

Key phenotypic assessments:

  • Nucleocytoplasmic transport (NCT) function:

    • Fluorescent reporter assays (GFP-NLS, GFP-NES, RFP-NLS, RFP-NES)

    • Quantitative analysis of nuclear/cytoplasmic distribution ratios

  • Neurodevelopmental parameters:

    • Neurite outgrowth assays

    • Branching complexity analysis

    • Synaptic marker expression

    • Electrophysiological properties

  • Nuclear morphology:

    • Assessment of nuclear deformation

    • Nuclear envelope integrity measurements

Genetic manipulation approaches:

  • RANBP17 knockdown: Using shRNAs to model loss of function

  • RANBP17 overexpression: Lentiviral vectors expressing GFP-tagged RANBP17 for rescue experiments

  • Domain-specific mutations: To determine which regions are critical for therapeutic effects

Complementary models:

  • Mouse models: For in vivo validation of findings from cellular models

  • Drosophila models: For high-throughput screening of genetic interactions

  • Organoid models: For 3D tissue organization studies

This multi-model approach provides robust validation of RANBP17's therapeutic potential in DYT1 dystonia and offers insights into fundamental mechanisms of nucleocytoplasmic transport in neurons.

How can researchers design experiments to elucidate the relationship between RANBP17 and cancer progression?

To investigate RANBP17's role in cancer progression, researchers should design experiments that address its context-specific functions across different cancer types, particularly its association with improved survival in HPV+ HNSCC :

Expression analysis in clinical samples:

  • Tissue microarray analysis: Compare RANBP17 expression across tumor types, stages, and HPV status

  • Correlation with patient outcomes: Validate findings from TCGA database showing positive correlation with survival in HPV+ HNSCC

  • Association with molecular markers: Investigate relationship with CDKN2A expression in HPV+ HNSCC

Functional studies in cancer cell lines:

  • Manipulation of RANBP17 expression:

    • Knockdown via RNAi or CRISPR/Cas9 (builds on previous RNAi studies showing reduced proliferation)

    • Overexpression using lentiviral vectors

    • Inducible expression systems for temporal control

  • Phenotypic assays:

    • Proliferation assays (previously shown to be affected by RANBP17 knockdown)

    • Apoptosis assessment

    • Migration and invasion assays

    • Colony formation in soft agar

    • Response to cisplatin and EGFR inhibitors (AG1478)

Mechanistic investigations:

  • Nucleocytoplasmic transport of cancer-relevant cargoes:

    • Track localization of key transcription factors (p53, NFκB, etc.)

    • Monitor RNA export of cancer-associated transcripts

  • Transcriptomic and proteomic analysis:

    • RNA-seq following RANBP17 manipulation

    • Proximity-based labeling to identify cancer-specific interaction partners

    • Focus on pathways relevant to cell cycle regulation and p21Waf1/Cip1 expression

In vivo models:

  • Xenograft studies with RANBP17-modified cancer cells

  • Patient-derived xenografts with varying RANBP17 expression levels

  • Genetic mouse models to assess effects of RANBP17 alteration on tumor initiation/progression

This comprehensive experimental approach would help elucidate whether RANBP17 functions as a tumor suppressor or oncogene in different contexts, potentially leading to new prognostic markers or therapeutic targets.

What are the emerging therapeutic applications for targeting RANBP17 in neurological disorders?

The recent discovery that RANBP17 overexpression can rescue neurodevelopmental deficits in DYT1 dystonia models opens several promising therapeutic avenues:

Potential therapeutic approaches targeting RANBP17:

  • Gene therapy strategies:

    • AAV-mediated delivery of RANBP17 to affected neurons

    • CRISPR activation systems to enhance endogenous RANBP17 expression

    • Cell-specific promoters to target expression to relevant neuronal populations

  • Small molecule screening:

    • Identify compounds that upregulate RANBP17 expression

    • Develop molecules that enhance RANBP17 nuclear transport activity

    • Screen for stabilizers of RANBP17 protein

  • Combination approaches:

    • Target RANBP17 alongside other nucleocytoplasmic transport factors

    • Combine with approaches addressing Torsin ATPase function

    • Develop multi-modal therapies addressing both NCT and neurodevelopmental pathways

Broader applications beyond DYT1 dystonia:

Neurological ConditionRationale for RANBP17 Targeting
Other dystonia subtypesNCT defects may be a common pathogenic mechanism
Neurodegenerative diseasesNCT dysfunction observed in ALS, Alzheimer's, and Huntington's disease
Neurodevelopmental disordersRANBP17's role in neurodevelopment suggests potential applications

Research priorities for therapeutic development:

  • Determine minimum effective levels of RANBP17 for therapeutic benefit

  • Establish temporal windows for intervention (developmental vs. adult stages)

  • Define cell type-specific requirements for RANBP17 function

  • Develop biomarkers to monitor nucleocytoplasmic transport restoration

  • Investigate potential side effects of RANBP17 overexpression, particularly in proliferative tissues

These emerging therapeutic applications represent a novel approach to treating neurological disorders through restoration of fundamental cellular transport processes.

What new technologies and methods could advance our understanding of RANBP17's function in cellular and disease contexts?

Several cutting-edge technologies and methodologies could significantly advance our understanding of RANBP17 biology:

Advanced imaging technologies:

  • Super-resolution microscopy (STORM, PALM, SIM) to visualize RANBP17 at nuclear pores with nanometer precision

  • Live-cell single-molecule tracking to monitor real-time dynamics of RANBP17-mediated transport

  • Correlative light and electron microscopy (CLEM) to link functional observations with ultrastructural context

  • Light-sheet microscopy for 3D visualization in organoids and tissue samples

Genomic and transcriptomic approaches:

  • Single-cell RNA-seq to identify cell type-specific expression patterns and responses to RANBP17 manipulation

  • Long-read sequencing to characterize novel RANBP17 isoforms and circular RNAs reported in literature

  • Spatial transcriptomics to map RANBP17 expression in complex tissues with spatial resolution

  • CRISPR screens to identify genetic modifiers of RANBP17 function

Protein interaction and structural studies:

  • Cryo-EM to determine high-resolution structures of RANBP17 transport complexes

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein-protein interfaces

  • Proximity labeling (BioID, APEX) to map the RANBP17 interactome in different cellular contexts

  • In-cell NMR to study RANBP17 structural dynamics in living cells

Translational technologies:

  • Induced pluripotent stem cell (iPSC) models from diverse patient populations

  • Brain organoids to study RANBP17 in complex 3D neural tissues

  • Microfluidic "organ-on-chip" platforms to assess RANBP17 function in tissue-specific contexts

  • AAV-mediated gene delivery to manipulate RANBP17 in vivo

Computational approaches:

  • Machine learning algorithms to predict transport cargo specificity

  • Molecular dynamics simulations to model RANBP17-cargo interactions

  • Network analysis to position RANBP17 within broader cellular pathways

  • Systems biology modeling of nucleocytoplasmic transport kinetics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.