Recombinant Rotavirus A Non-structural glycoprotein 4, partial

Shipped with Ice Packs
In Stock

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is Tris/PBS-based, containing 5%-50% glycerol.

Note: If you require a specific glycerol concentration, please indicate your preference during order placement.

For lyophilized powder delivery forms, the buffer used before lyophilization is Tris/PBS-based, containing 6% Trehalose.
Form
Delivery forms are available as either Liquid or Lyophilized powder.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate your preference during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.

Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Synonyms
Non-structural glycoprotein 4; NSP4; NCVP5; NS28
Datasheet & Coa
Please contact us to get it.
Expression Region
52-175aa
Mol. Weight
21.7 kDa
Protein Length
Cytoplasmic Domain
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)
Target Protein Sequence
PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
NSP4 plays a crucial role in the rotavirus replication cycle by functioning as a viroporin. It creates a pore in the host's endoplasmic reticulum, leading to the release of Ca(2+) into the cytoplasm of infected cells. Consequently, elevated cytoplasmic calcium levels trigger membrane trafficking and the transport of viral ER-associated proteins to viroplasms, which are sites of viral genome replication and immature particle assembly.

The secreted form of NSP4 acts as an enterotoxin, causing phospholipase C-dependent elevation of intracellular calcium concentration in host intestinal mucosa cells. Increased intracellular calcium disrupts the cytoskeleton and tight junctions, leading to increased paracellular permeability. NSP4 potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To exert its enterotoxigenic function in vivo, NSP4 is released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with host plasma membrane receptors on neighboring epithelial cells, such as integrins ITGA1/ITGB1 and ITGA2/ITGB1.
Protein Families
Rotavirus NSP4 family
Subcellular Location
Host rough endoplasmic reticulum membrane; Single-pass type III membrane protein. Host membrane, host caveola; Single-pass type III membrane protein. Secreted.

Q&A

What is Rotavirus A NSP4 and what are its primary biological functions?

NSP4 is a multifunctional non-structural glycoprotein produced by Rotavirus A that plays critical roles in viral pathogenesis. Its primary functions include:

  • Acting as a viral morphogenesis mediator by functioning as an intracellular receptor for immature double-layered inner capsid particles (ICPs) that transiently bud into the endoplasmic reticulum lumen during viral maturation

  • Serving as a viral enterotoxin that triggers phospholipase C-dependent elevation of intracellular calcium concentrations in host intestinal mucosa cells

  • Disrupting cytoskeletal organization and tight junctions, which increases paracellular permeability in epithelial cells

  • Potentiating chloride ion secretion through calcium-dependent signaling pathways, which induces age-dependent diarrhea

  • Facilitating intercellular calcium wave propagation from infected to uninfected cells, which contributes to disease severity

The partial recombinant NSP4 (52-175 aa) retains many of these key functional domains while being easier to express and purify for research applications.

What expression systems are commonly used for producing recombinant NSP4 protein?

Multiple expression systems have been successfully employed to produce recombinant NSP4, each with distinct advantages:

E. coli Expression System:

  • Used for producing Rotavirus A NSP4 (52-175 aa) with His-SUMO tag (molecular mass: 30.6 kDa)

  • Provides high yield but may require additional optimization for proper folding

Yeast Expression System:

  • Successfully utilized for expression of Rotavirus A NSP4 (52-175 aa) with His tag (molecular mass: 16.7 kDa)

  • Previously verified through Western Blot analysis of raw samples extracted from transformed yeast cells

  • May provide better post-translational modifications than bacterial systems

Both systems produce recombinant NSP4, but researchers should select the appropriate system based on their specific experimental requirements, including tag preferences, downstream applications, and purification strategies.

What are the optimal purification strategies for recombinant NSP4?

Purifying recombinant NSP4 presents specific challenges that can be addressed through a multi-step approach:

Step 1: Initial Extraction

  • For bacterial or yeast expression systems, cell lysis under denaturing conditions may improve initial yield

  • Inclusion of appropriate protease inhibitors is essential to prevent degradation

Step 2: Primary Purification

  • Gravimetric gel filtration chromatography significantly increases NSP4 purity

  • Optimized elution solvents enhance protein separation:

    • 20% acetonitrile as primary eluting solvent

    • Addition of SDS to the eluting buffer substantially improves protein separation and results in cleaner NSP4 fractions

Step 3: Affinity Purification

  • Using anti-NSP4 antibodies (such as Rabbit-Anti-NSP4₁₅₀₋₁₇₅) conjugated to beads provides high specificity

  • Multiple rounds of affinity purification may be necessary to achieve >90% purity

  • Western blot and silver stain analyses should be performed to verify purification success

Critical Considerations:

  • NSP4 yield from affinity columns can be exceptionally low, requiring optimization of initial load amounts

  • Sample pooling, dialysis, and lyophilization may be necessary between purification steps

  • Protein concentrations should be monitored using sensitive methods such as nano-drop analysis

How can researchers verify the purity and functionality of recombinant NSP4?

Multiple complementary analytical techniques should be employed to verify both purity and functionality:

Purity Assessment:

  • SDS-PAGE with silver staining to detect minor contaminants (targeted purity >90%)

  • Western blot analysis using NSP4-specific antibodies to confirm identity and integrity

  • Mass spectrometry for precise molecular weight determination and detection of potential modifications

Functionality Assessment:

  • Calcium signaling assays in epithelial cell models to verify enterotoxic activity

  • Binding assays with double-layered particles to confirm receptor functionality

  • Phospholipase C activation assays to verify signaling pathway induction

Storage Considerations:

  • Avoid repeated freeze-thaw cycles which compromise protein integrity

  • Store working aliquots at 4°C for up to one week

  • For longer-term storage, maintain at -20°C/-80°C in appropriate buffer with 50% glycerol

How does NSP4 mediate calcium signaling disruption in rotavirus pathogenesis?

Recent research has revealed NSP4's sophisticated role in calcium signaling disruption:

NSP4 triggers aberrant calcium signaling through multiple mechanisms:

  • Initiates phospholipase C-dependent elevation of intracellular calcium in infected intestinal cells

  • Generates "intercellular calcium waves" that radiate from infected cells to neighboring uninfected cells

  • Functions as both a necessary and sufficient factor for multiple aspects of calcium disruption during rotavirus infection

A 2025 study from Baylor College of Medicine demonstrated that:

  • NSP4 alone can fully account for the ability of rotavirus to generate calcium waves

  • Expression of NSP4 in isolation reproduces calcium signaling disruptions observed during complete viral infection

  • Inhibition of these calcium signals significantly reduces disease severity in experimental models

These findings suggest two important research directions:

  • Developing calcium signaling modulators as potential therapeutic interventions

  • Exploring NSP4 mutants with altered calcium signaling properties as candidate attenuated vaccine strains

What experimental approaches are most effective for studying NSP4-host interactions?

Multiple complementary experimental approaches provide insights into NSP4-host interactions:

Structural Analysis Techniques:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to examine protein dynamics and identify flexible regions

  • Nuclear magnetic resonance (NMR) spectroscopy for characterizing disordered domains and binding interfaces

  • X-ray crystallography for high-resolution structural determination of ordered domains

Functional Analysis Approaches:

  • Trans-replicase systems with structure-guided mutagenesis to identify regions critical for viral replication

  • Live-cell calcium imaging to visualize NSP4-induced calcium waves in real-time

  • Co-immunoprecipitation studies to identify direct binding partners of NSP4

Advanced Cell Biology Methods:

  • Surface biotinylation assays to detect NSP4 trafficking to the plasma membrane

  • Confocal microscopy with fluorescently-tagged NSP4 to track its intracellular movement

  • Caveolae isolation techniques to study NSP4 association with these membrane microdomains

Research has demonstrated that NSP4 traffics to plasma membrane caveolae through an unconventional Golgi-bypassing secretory pathway, directly interacting with caveolin-1, cholesterol, and soluble immunophilin complexes .

What are the key differences between NSP4 variants from different rotavirus strains?

Comparative analysis of NSP4 sequences from different rotavirus strains reveals important structural and functional variations:

Sequence Variation Analysis:

StrainOriginKey Sequence DifferencesPotential Functional Impact
SA11-H96SimianTVQTTGE at positions 140-146May affect binding to host factors
DS-1HumanMVRSTDE at positions 140-146Possibly altered calcium signaling properties

Both sequences preserve the core functional domains but exhibit strain-specific variations that could contribute to differences in:

  • Host range specificity

  • Pathogenic potential

  • Immune recognition

  • Interaction with cellular components

Structural Implications:
The comparison of simian and human NSP4 sequences reveals substitutions primarily in regions that may influence:

  • Protein-protein interaction interfaces

  • Conformational dynamics

  • Binding affinity to target receptors

These differences may explain strain-specific variations in virulence and could inform the development of strain-specific therapeutic strategies.

What are the major challenges in working with recombinant NSP4 and how can they be addressed?

Researchers face several significant challenges when working with recombinant NSP4:

Purification Challenges:

  • Extremely low yields of purified protein from affinity columns

  • Presence of contaminating proteins that co-purify with NSP4

  • Potential for protein aggregation during concentration steps

Potential Solutions:

  • Optimization of expression conditions (temperature, induction time, media composition)

  • Exploration of alternative tags that may improve solubility and purification efficiency

  • Development of improved affinity resins with higher binding capacity for NSP4

Stability Issues:

  • Protein degradation during storage and handling

  • Functional loss after freeze-thaw cycles

  • Conformational changes affecting activity

Recommended Approaches:

  • Single-use aliquots to avoid repeated freeze-thaw cycles

  • Addition of stabilizing agents (glycerol, reducing agents) to storage buffers

  • Functional testing before experimental use to ensure activity is maintained

How might understanding NSP4 function lead to novel therapeutic strategies?

Recent discoveries about NSP4's role in rotavirus pathogenesis suggest several promising therapeutic approaches:

Targeting Calcium Signaling:

  • Development of specific inhibitors that block NSP4-induced calcium wave propagation

  • The 2025 Baylor College study demonstrated that inhibition of calcium signals reduced disease severity, validating this approach

Disrupting NSP4-Host Protein Interactions:

  • Identification of small molecules that interfere with NSP4 binding to caveolin-1 or integrin receptors

  • Peptide inhibitors designed to mimic interaction domains and competitively inhibit binding

NSP4-Based Vaccine Development:

  • Engineering attenuated NSP4 variants that maintain immunogenicity but lack enterotoxic activity

  • Development of subunit vaccines incorporating recombinant NSP4 with appropriate adjuvants

Gene-Targeted Approaches:

  • siRNA or antisense oligonucleotides designed to reduce NSP4 expression during infection

  • CRISPR-based strategies to modify host receptors for NSP4

These approaches represent a paradigm shift from traditional antiviral strategies to targeted interventions based on detailed molecular understanding of NSP4's role in rotavirus pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.