Recombinant 34 kDa antigenic protein homolog (Mb0979)

Shipped with Ice Packs
In Stock

Description

Table 1: Biochemical Properties of Recombinant Mb0979

PropertyDetails
Molecular Weight34 kDa (native); 37.1 kDa with His-tag
Amino Acid Sequence303 residues (full-length), including hydrophobic regions indicative of transmembrane domains
Expression SystemsE. coli, mammalian cells, yeast, and cell-free systems
Purity≥85% (SDS-PAGE)
StorageLyophilized or liquid form at -20°C/-80°C; avoid repeated freeze-thaw cycles

The full-length protein (1–303 aa) is typically fused with an N-terminal His-tag for affinity purification . Heterologous expression in E. coli yields soluble protein, while mammalian and yeast systems are used for post-translational modifications .

Immunological Relevance

Studies on homologous PPE proteins in Mycobacterium avium subsp. paratuberculosis (Map) highlight the antigenic potential of this protein family:

  • Cellular Immune Response: A recombinant 34.9 kDa PPE protein from Map elicited delayed-type hypersensitivity (DTH) in mice, suggesting T-cell antigenicity .

  • Antibody Recognition: Polyclonal antibodies against the recombinant protein recognized both the purified antigen and native mycobacterial sonicates, confirming cross-reactivity .

  • Hydrophobic Domains: Three hydrophobic regions (aa 25–30, 245–255, 335–350) may facilitate membrane localization, a common feature in pathogenic mycobacterial proteins .

Table 2: Research and Diagnostic Applications

ApplicationDetails
ELISA DevelopmentUsed as a coating antigen in ELISA kits for detecting mycobacterial infections
ImmunoblottingValidates protein expression and antigenicity in host systems
Cellular ImmunityAssesses DTH responses in animal models of tuberculosis
Structural StudiesInvestigates membrane protein topology and host-pathogen interactions

Challenges and Considerations

  • Stability: Requires storage at -80°C with glycerol (5–50%) to prevent aggregation .

  • Species Specificity: Antibodies against Mb0979 may cross-react with PPE proteins from other mycobacteria (e.g., M. tuberculosis Rv0954) .

  • Research Gaps: Functional studies on Mb0979-specific immune responses in bovine tuberculosis remain limited.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
BQ2027_MB0979; 34 kDa antigenic protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0979
Target Protein Sequence
MTYSPGNPGYPQAQPAGSYGGVTPSFAHADEGASKLPMYLNIAVAVLGLAAYFASFGPMF TLSTELGGGDGAVSGDTGLPVGVALLAALLAGVALVPKAKSHVTVVAVLGVLGVFLMVSA TFNKPSAYSTGWALWVVLAFIVFQAVAAVLALLVETGAITAPAPRPKFDPYGQYGRYGQY GQYGVQPGGYYGQQGAQQAAGLQSPGPQQSPQPPGYGSQYGGYSSSPSQSGSGYTAQPPA QPPAQSGSQQSHQGPSTPPTGFPSFSPPPPVSAGTGSQAGSAPVNYSNPSGGEQSSSPGG APV
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant 34 kDa Antigenic Protein Homolog (Mb0979)?

The Recombinant 34 kDa Antigenic Protein Homolog (Mb0979) is a full-length protein (303 amino acids) from Mycobacterium bovis, commonly expressed with a His-tag in E. coli expression systems. It belongs to the family of mycobacterial antigenic proteins with potential roles in host-pathogen interactions and immunological responses. The protein derives from the M. bovis genome and has been studied in the context of bovine tuberculosis pathogenesis and immune response .

How is Mb0979 typically expressed in laboratory settings?

Mb0979 is typically expressed as a recombinant protein in E. coli expression systems. The standard methodology involves cloning the gene into an expression vector (similar systems to pQE30 UA that has been used for related mycobacterial proteins), transformation into an appropriate E. coli strain (such as M15), followed by IPTG induction. This approach typically yields 15-20 mg/L of culture at shake flask level for similar mycobacterial proteins. The expressed protein can be purified using Ni-NTA agarose chromatography when expressed with a His-tag, resulting in approximately 80% purity as visualized by SDS-PAGE .

What is the relationship between Mb0979 and the PPE protein family?

While the search results don't directly classify Mb0979 as a PPE protein, related mycobacterial antigenic proteins often belong to the PPE family, which are characterized by Proline-Proline-Glutamic acid (PPE) motifs near their N-termini. PPE proteins are known to play roles as T cell antigens and in host-pathogen interactions. The M. bovis genome contains multiple PPE family proteins, and researchers often study their antigenic properties collectively. These proteins typically contain conserved N-terminal domains of 180-200 amino acids and can induce cellular immune responses, making them candidates for vaccine development and diagnostic tests .

What structural features characterize the Mb0979 protein?

For mycobacterial proteins like Mb0979, structural analysis typically reveals characteristic hydrophobic regions that may indicate membrane association or protein-protein interaction domains. Similar mycobacterial antigenic proteins contain three major hydrophobic regions (for example, at amino acids 25-30, 245-255, and 335-350 in related proteins). These structural features can be predicted using algorithms like the Kyte and Doolittle method to identify potential membrane segments. The presence of these hydrophobic regions suggests that Mb0979 may interact with cell membranes or have distinct structural domains that contribute to its antigenic properties .

How can researchers predict potential epitopes in Mb0979 for immunological studies?

Researchers can predict potential epitopes in Mb0979 through computational analysis of its amino acid sequence. This involves:

  • Analyzing the primary sequence for hydrophilicity, flexibility, and accessibility

  • Employing epitope prediction algorithms that consider factors such as surface exposure and secondary structure

  • Comparing with known epitopic regions of related mycobacterial proteins

For experimental validation, researchers should consider amplifying epitopic regions by PCR, expressing them as recombinant fragments, and testing their immunoreactivity through techniques such as western blotting and ELISA with serum from infected animals. Additionally, these epitopes can be evaluated for their ability to elicit delayed-type hypersensitivity (DTH) responses in sensitized animal models .

What are the optimal conditions for expressing soluble Mb0979 protein?

Based on experience with similar mycobacterial proteins, the optimal conditions for expressing soluble Mb0979 include:

ParameterOptimal Condition
Expression hostE. coli M15 or BL21(DE3) strains
Induction temperature25-30°C (lowered from 37°C to increase solubility)
IPTG concentration0.5-1.0 mM
Induction time4-6 hours (or overnight at 18°C)
MediaEnriched media (2XYT or TB) with appropriate antibiotics
OD600 at induction0.6-0.8

These conditions typically yield 15-20 mg/L of culture at shake flask level for similar mycobacterial proteins. Additionally, including solubility enhancers such as 1% glucose in the pre-induction media or 0.5M sorbitol and 2.5mM betaine in the expression media may improve soluble protein yield .

What purification strategy yields the highest purity of Mb0979 for immunological studies?

A multi-step purification strategy is recommended to achieve high purity Mb0979 suitable for immunological studies:

  • Initial capture using Ni-NTA agarose chromatography (for His-tagged protein)

    • Lysis in buffer containing 50mM Tris-HCl pH 8.0, 300mM NaCl, 10mM imidazole, 1mM PMSF

    • Washing with increasing imidazole concentrations (20-40mM)

    • Elution with 250-300mM imidazole

  • Secondary purification using ion-exchange chromatography

    • Dialysis to remove imidazole

    • Application to Q-Sepharose (anion exchange) or SP-Sepharose (cation exchange) depending on the protein's pI

  • Final polishing step using size exclusion chromatography

    • Superdex 75 or 200 column equilibrated with PBS or similar buffer

This approach typically yields >95% pure protein as assessed by SDS-PAGE. For immunological studies, endotoxin removal using polymyxin B columns or Triton X-114 phase separation is recommended, with final endotoxin levels confirmed to be <0.1 EU/μg protein .

How effective is Mb0979 in eliciting cell-mediated immune responses relevant to tuberculosis?

The immunological effectiveness of Mb0979 must be experimentally determined, but related mycobacterial antigenic proteins have demonstrated capacity to elicit cell-mediated immune responses. For example, similar recombinant antigenic proteins from mycobacteria have shown the ability to induce significant delayed-type hypersensitivity (DTH) reactions in sensitized animals.

When testing DTH responses with similar proteins, mice sensitized with Mycobacterium showed skin reactions with mean induration diameters of approximately 3.12 ± 0.4 mm when challenged with the recombinant protein, compared to 3.95 ± 0.5 mm with standard tuberculin PPD. This suggests that while such proteins can induce cellular immunity, their potency may be somewhat less than whole-cell derived PPD, likely due to PPD containing multiple antigenic components compared to a single recombinant protein .

What are the best methods to assess the cellular immune response to Mb0979 in vitro?

To comprehensively assess cellular immune responses to Mb0979 in vitro, researchers should employ multiple complementary approaches:

  • Lymphocyte proliferation assays

    • Isolate peripheral blood mononuclear cells (PBMCs) from infected/vaccinated and control animals

    • Stimulate with purified Mb0979 at concentrations of 5-20 μg/mL

    • Measure proliferation via 3H-thymidine incorporation or CFSE dilution

  • Cytokine profiling

    • Quantify IFN-γ, TNF-α, IL-2, and IL-17 production using ELISA or ELISpot

    • Perform intracellular cytokine staining to identify responding T cell subsets

  • T cell phenotyping

    • Use flow cytometry to characterize CD4+/CD8+ T cell activation (CD69, CD25)

    • Assess memory markers (CD44high, CD62Llow/high) on responding cells

  • Functional killing assays

    • Evaluate whether Mb0979-specific T cells can recognize and kill infected macrophages

    • Assess reduction in bacterial load in infected macrophages co-cultured with Mb0979-stimulated T cells

These methods collectively provide a comprehensive profile of the cellular immune response quality and quantity, which is critical for vaccine candidate evaluation .

How can Mb0979 be incorporated into a reverse vaccinology approach for bovine tuberculosis?

To incorporate Mb0979 into a reverse vaccinology approach for bovine TB vaccine development:

  • Confirmation of antigenicity and immunogenicity

    • Assess B and T cell epitope distribution using prediction algorithms and experimental validation

    • Compare sequence conservation across M. bovis strains to ensure broad protection

    • Test purified protein for immunoreactivity with sera from naturally infected cattle

  • Formulation strategies

    • Evaluate different adjuvant combinations (oil-in-water emulsions, TLR agonists, nanoparticles)

    • Test prime-boost regimens incorporating Mb0979 with other complementary antigens

    • Consider DNA vaccine encoding Mb0979 followed by protein boost

  • Delivery system optimization

    • Test incorporation into liposomes or virus-like particles to enhance uptake

    • Evaluate mucosal delivery systems for respiratory tract targeting

    • Consider fusion with immunostimulatory molecules like flagellin

  • In vivo testing pipeline

    • Initial screening in mice for immunogenicity and safety

    • Follow-up studies in cattle to assess protection metrics

    • Challenge studies to determine efficacy against M. bovis infection

This systematic approach allows for rational vaccine design incorporating Mb0979 as one component of potentially multi-antigen subunit vaccines for bovine tuberculosis .

What strategies can be employed to improve the solubility and yield of Mb0979 for structural studies?

For structural studies requiring high yields of soluble Mb0979, researchers should implement these advanced strategies:

  • Expression system optimization

    • Test alternative expression systems including insect cells (baculovirus) which have shown success with mycobacterial proteins

    • Evaluate cell-free protein synthesis systems for difficult-to-express constructs

    • Consider codon optimization specific to the expression host

  • Fusion partners and solubility tags

    • Screen multiple fusion partners beyond just His-tag (MBP, SUMO, TrxA, GST)

    • Implement solubility-enhancing peptides such as SET tag or Fh8

    • Use cleavable tags with precision proteases (TEV, 3C) that leave minimal residues

  • Protein engineering approaches

    • Perform targeted mutagenesis of hydrophobic patches identified by computational analysis

    • Create truncated constructs guided by structural predictions and disorder analysis

    • Consider surface entropy reduction through lysine/glutamate mutations to alanine

  • Advanced cultivation techniques

    • Implement fed-batch fermentation with controlled nutrient delivery

    • Test auto-induction media formulations to eliminate monitoring requirements

    • Optimize dissolved oxygen levels and pH control for maximum expression

For exceptional cases, chaperone co-expression (GroEL/ES, DnaK/J) can dramatically improve folding of difficult mycobacterial proteins, sometimes increasing soluble yield by 5-10 fold .

How can researchers differentiate between the immune responses to Mb0979 versus other mycobacterial antigens in complex samples?

Differentiating immune responses to Mb0979 from responses to other mycobacterial antigens requires sophisticated methodological approaches:

  • Epitope mapping and competitive binding assays

    • Identify Mb0979-specific epitopes through overlapping peptide ELISA

    • Use these epitopes to develop competitive ELISA systems where Mb0979-specific peptides block binding to whole protein

    • Implement peptide-MHC tetramer assays to enumerate antigen-specific T cells

  • Depletion and enrichment strategies

    • Selectively deplete Mb0979-reactive antibodies/T cells using immobilized purified protein

    • Compare immune responses before and after depletion to quantify Mb0979-specific contribution

    • Use protein-loaded magnetic beads to enrich for Mb0979-specific lymphocytes

  • Advanced multiplexing techniques

    • Develop multiplex cytokine assays with Mb0979 and other antigens in parallel

    • Implement single-cell technologies (mass cytometry, single-cell RNA-seq) to profile polyfunctionality

    • Use fluorescently labeled multimers containing different antigens simultaneously

  • Cross-reactivity assessment

    • Test immune responses against homologous proteins from related mycobacterial species

    • Identify unique regions of Mb0979 with minimal homology to other proteins

    • Develop blocking assays using related proteins to determine specificity

What are common challenges in expressing Mb0979 and how can they be overcome?

Researchers frequently encounter several challenges when expressing mycobacterial proteins like Mb0979:

ChallengeSolution Approach
Insolubility/inclusion bodies- Lower induction temperature (16-25°C)
- Reduce IPTG concentration to 0.1-0.3 mM
- Add solubility enhancers (10% glycerol, 1% glucose)
- Use solubility tags (MBP, SUMO)
Proteolytic degradation- Add protease inhibitors during purification
- Include 1-2 mM EDTA in buffers
- Use protease-deficient E. coli strains
- Purify rapidly at 4°C
Low expression- Check for rare codons and use appropriate E. coli strains
- Optimize codon usage for expression host
- Test different promoters (T7, tac, BAD)
- Verify sequence integrity
Toxicity to host cells- Use tight expression control (pET system with T7 lysozyme)
- Employ glucose to suppress basal expression
- Consider cell-free expression systems
Protein aggregation- Include stabilizing agents (arginine, trehalose)
- Optimize buffer conditions (pH, salt concentration)
- Add low concentrations of non-ionic detergents (0.05% Tween-20)

For particularly difficult expressions, alternative approaches like insect cell expression systems have shown success with mycobacterial proteins, with over 60% of M. bovis proteins showing soluble expression in either E. coli or insect cell systems .

How should researchers validate the identity and integrity of purified Mb0979?

To ensure the identity and integrity of purified Mb0979, researchers should implement a comprehensive validation strategy:

  • Primary structure confirmation

    • N-terminal sequencing of the first 10-15 amino acids

    • Peptide mass fingerprinting after tryptic digestion

    • Full protein mass spectrometry to confirm accurate molecular weight

    • If applicable, verification of His-tag presence via anti-His Western blot

  • Secondary/tertiary structure assessment

    • Circular dichroism (CD) spectroscopy to confirm proper folding

    • Intrinsic fluorescence to assess tryptophan environment

    • Thermal shift assays to determine stability and folding state

    • Dynamic light scattering to assess monodispersity

  • Functional validation

    • Immunoreactivity with polyclonal antibodies raised against M. bovis

    • Ability to elicit immune responses in appropriate cell-based assays

    • Binding studies with potential interaction partners if known

  • Purity assessment

    • SDS-PAGE with sensitive staining methods (silver stain)

    • Reverse-phase HPLC analysis

    • Endotoxin testing (LAL assay) to ensure levels <0.1 EU/μg protein

This multifaceted approach ensures that the purified protein maintains both its primary sequence integrity and native-like folding necessary for immunological and structural studies .

How does Mb0979 compare to homologous proteins in other mycobacterial species?

Comparative analysis of Mb0979 with homologous proteins in other mycobacterial species reveals important insights into evolutionary conservation and functional specialization:

While specific comparative data for Mb0979 is limited in the search results, the approach to such comparison would involve:

  • Sequence homology analysis

    • Perform BLAST searches against mycobacterial genomes

    • Create multiple sequence alignments to identify conserved motifs

    • Calculate percent identity/similarity across species

  • Structural comparison

    • Compare predicted secondary structure elements

    • Identify conserved versus variable regions

    • Assess conservation of key functional domains

  • Immunological cross-reactivity

    • Test antibodies raised against Mb0979 for recognition of homologs

    • Evaluate T cell epitope conservation across species

    • Assess cross-protection potential in vaccination studies

Similar analyses with other mycobacterial proteins have revealed that while core structural elements are often conserved, epitopic regions may vary significantly, explaining species-specific immune responses. This information is crucial for developing diagnostics that can differentiate between M. bovis infection and exposure to environmental mycobacteria or vaccination .

What experimental approaches can distinguish between the immunological effects of Mb0979 and BCG vaccination?

To differentiate between immune responses induced by Mb0979 and conventional BCG vaccination, researchers should employ these experimental approaches:

  • Epitope-specific immune assays

    • Identify Mb0979 epitopes absent in BCG through comparative genomics

    • Develop peptide-based ELISA or ELISpot assays targeting these regions

    • Quantify responses in Mb0979-immunized versus BCG-vaccinated animals

  • Multidimensional immune profiling

    • Compare cytokine signatures (IFN-γ, TNF-α, IL-2, IL-17) between groups

    • Assess T cell subset involvement (CD4+ vs CD8+ vs γδ T cells)

    • Analyze memory phenotypes generated by each immunization approach

  • Challenge studies with readout differentiation

    • Perform aerosol M. bovis challenge in both immunization groups

    • Compare bacterial load reduction, pathology scores, and survival

    • Correlate protection with Mb0979-specific versus BCG-induced responses

  • Systems biology approach

    • Perform transcriptomic analysis of immune cells after stimulation

    • Identify gene expression signatures unique to each immunization

    • Map immune network interactions specific to Mb0979 versus whole BCG

These approaches collectively allow researchers to determine whether Mb0979-based subunit vaccines offer advantages over traditional BCG vaccination, potentially informing the development of more effective and specific vaccines for bovine tuberculosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.