Recombinant 34 kDa antigenic protein homolog (Rv0954, MT0981)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant 34 kDa Antigenic Protein Homolog (Rv0954, MT0981)

The Recombinant 34 kDa antigenic protein homolog (Rv0954, MT0981) is a protein of interest in the field of microbiology, particularly in the study of Mycobacterium tuberculosis and related species. This protein is identified by the accession number Rv0954 in M. tuberculosis and MT0981 in other mycobacterial species. It is described as a probable conserved transmembrane protein with a gene length of 912 nucleotides and a protein length of 303 amino acids .

Function and Significance

While specific functions of Rv0954/MT0981 are not extensively detailed in available literature, its classification as a transmembrane protein suggests it may play roles in cell membrane processes, such as transport or signaling. Transmembrane proteins are crucial for maintaining cellular integrity and facilitating interactions between the cell and its environment.

Research Findings

Research on Rv0954/MT0981 is limited, but it is part of broader studies on mycobacterial genomes. These studies aim to understand the genetic makeup and potential antigenic targets for vaccine development or diagnostic tools. The protein's conserved nature across different mycobacterial species indicates its potential importance in the biology of these organisms.

Future Research Directions

Future research on Rv0954/MT0981 could involve:

  • Structural Analysis: Determining the three-dimensional structure of the protein to better understand its function.

  • Functional Studies: Investigating the protein's role in mycobacterial physiology and pathogenesis.

  • Immunological Studies: Evaluating its potential as an antigen for diagnostic or vaccine applications.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize development of the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Target Names
Rv0954, MT0981
Target Protein Sequence
MTYSPGNPGYPQAQPAGSYGGVTPSFAHADEGASKLPMYLNIAVAVLGLAAYFASFGPMF TLSTELGGGDGAVSGDTGLPVGVALLAALLAGVALVPKAKSHVTVVAVLGVLGVFLMVSA TFNKPSAYSTGWALWVVLAFIVFQAVAAVLALLVETGAITAPAPRPKFDPYGQYGRYGQY GQYGVQPGGYYGQQGAQQAAGLQSPGPQQSPQPPGYGSQYGGYSSSPSQSGSGYTAQPPA QPPAQSGSQQSHQGPSTPPTGFPSFSPPPPVSAGTGSQAGSAPVNYSNPSGGEQSSSPGG APV
Uniprot No.

Q&A

What is Rv0954 and where is it found?

Rv0954 is a previously uncharacterized protein that functions as a component of the mycobacterial cell division complex (divisome). It is a member of the 219 mycobacterial "core" genes conserved among mycobacterial species without homologs in other bacteria. The protein is specifically found in Mycobacterium tuberculosis (Mtb) and related mycobacterial species . Rv0954 is considered non-essential for growth in rich medium according to saturating transposon mutagenesis studies, suggesting potential functional redundancy within the cell division system .

What is the structural composition of Rv0954?

Rv0954 is a membrane protein containing four transmembrane helixes (TMHs) flanked by cytoplasmic N- and C-termini. Its C-terminal half (amino acids 155-303) is notably rich in proline (18%) and glutamine residues (15%), characteristics that typically form extended and rigid structures. This structural arrangement may allow Rv0954 to protrude significantly into the cytoplasm, facilitating interactions with other cell division components . The protein's structural features are consistent with potential roles in scaffolding or anchoring other divisome components to the cell membrane.

How does Rv0954 localize during the cell cycle?

Rv0954 displays a specific localization pattern during mycobacterial cell division. Live-cell imaging studies using fluorescent reporter strains have revealed that Rv0954:

  • Initially localizes to the membrane in pre-divisional cells

  • Accumulates at the mid-cell before septum formation

  • Persists at the mid-cell until cell constriction is completed

This temporal localization pattern occurs after FtsZ (an early divisome component) but before visible septum formation, suggesting Rv0954 is recruited during intermediate stages of divisome assembly .

What experimental methods are used to study Rv0954 localization?

Researchers employ several techniques to study Rv0954 localization:

  • Fluorescent protein fusion imaging: Creating Rv0954-fluorescent protein fusions to visualize its localization in live cells

  • Co-localization studies: Comparing Rv0954 localization timing with known cell division markers including:

    • FtsZ (early divisome marker)

    • FM5-95 membrane dye (septum formation marker)

    • Wag31 (septum closure marker)

  • Quantitative analysis: Calculating the percentage of cells showing mid-cell localization relative to other divisome markers

The comparative timing of localization helps establish Rv0954's role in the sequence of divisome assembly events.

What protein-protein interactions does Rv0954 form during cell division?

Rv0954 interacts with several proteins involved in mycobacterial cell division and cell wall biosynthesis. Immunoprecipitation followed by mass spectrometry identified 19 interaction partners, with key divisome-related proteins including:

Interaction PartnerFunctionSignificance
PknHSerine/threonine protein kinaseRegulates cell division
LamA (MmpS3)Septal-localizing proteinInhibits cell elongation from new pole
PbpATranspeptidaseInvolved in peptidoglycan crosslinking

Co-immunoprecipitation experiments specifically confirmed the interaction between Rv0954 and PknH in Mycobacterium smegmatis (Msm) . These interactions further support Rv0954's involvement in cell division processes and suggest potential regulatory relationships.

How does phosphorylation affect Rv0954 function?

Rv0954 undergoes phosphorylation in Mtb, likely mediated by its interaction partner PknH. Research has identified four specific phosphorylation sites in the C-terminus of Rv0954:

  • Threonine 257 (T257)

  • Serine 248 (S248)

  • Serine 256 (S256)

  • Serine 264 (S264)

Experimental evidence for phosphorylation includes:

  • Downshifting of protein bands upon alkaline phosphatase treatment

  • Mass spectrometry identification of specific phosphorylation sites

  • Creation and analysis of phospho-ablative (PA4) and phospho-mimetic (PD4) mutants

What approaches can be used to study the phenotypic effects of Rv0954 deletion?

Despite Rv0954's involvement in cell division, its deletion does not produce obvious phenotypes, suggesting functional redundancy. Researchers have employed several approaches to characterize potential subtle effects:

  • Microscopic analysis: Examining cell morphology and septum formation

  • Growth assays: Testing growth under various stress conditions

    • Acidic pH

    • Reduced magnesium concentration

  • Antibiotic susceptibility testing: Challenging with cell wall-targeting compounds

  • Transposon sequencing (Tnseq): Comparing transposon insertion profiles between wild-type and Δrv0954 mutant to identify genetic interactions

The Tnseq approach is particularly valuable as it revealed that several genes, especially those encoding cell division proteins, become more critical when Rv0954 is absent, suggesting compensatory pathways.

What genetic interactions has Rv0954 been shown to have?

Transposon sequencing (Tnseq) experiments revealed that deletion of rv0954 creates dependencies on several genes, particularly those encoding integral membrane proteins involved in cell division. Key genetic interactions include:

GeneProteinFunctionRelevance
rv0016cPbpATranspeptidasePeptidoglycan crosslinking during division
rv0017cRodAPeptidoglycan synthaseInvolved in septum formation
rv0383cPerMDivisome componentIn same operon as rv0954
rv1159PimEMannosyltransferaseCell wall biosynthesis
rv2553cPutative transglycosylaseLocalizes to septum and polesInteracts with FtsQ
rv0200MmpS3/LamASeptal-localizing proteinInhibits cell elongation

These findings demonstrate that Rv0954 has overlapping functions with multiple cell division components, explaining why its deletion alone doesn't cause obvious phenotypes .

What methods are recommended for studying potential scaffold functions of Rv0954?

To investigate Rv0954's potential role as a scaffold or anchor for divisome components, researchers might employ:

  • Bacterial two-hybrid or split-GFP assays: To map protein-protein interaction domains

  • Site-directed mutagenesis: Targeting the proline/glutamine-rich C-terminal domain to assess its role in protein interactions

  • Super-resolution microscopy: To precisely localize Rv0954 relative to other divisome components

  • Cross-linking mass spectrometry: To identify direct physical contacts between Rv0954 and other proteins

  • In vitro reconstitution assays: Testing if Rv0954 can recruit divisome components to artificial membrane systems

These approaches would help determine whether Rv0954 functions similarly to proteins like ZipA in E. coli, which anchors FtsZ to the membrane, though evidence suggests Rv0954 likely anchors proteins other than FtsZ given their different localization timing .

How can Rv0954 be effectively expressed and purified for structural studies?

For effective expression and purification of Rv0954:

  • Expression system selection: Membrane proteins like Rv0954 with four transmembrane domains present challenges. Consider:

    • E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Mycobacterial expression systems for native folding

    • Cell-free expression systems with appropriate detergents

  • Solubilization strategies:

    • Use mild detergents (DDM, LMNG) to extract Rv0954 from membranes

    • Consider nanodiscs or amphipols for stabilization

    • Test detergent-free extraction using SMALPs (styrene maleic acid lipid particles)

  • Purification approach:

    • Affinity chromatography using C-terminal tags (the cytoplasmic C-terminus is amenable to tagging)

    • Size exclusion chromatography to assess oligomeric state

    • Anion/cation exchange as secondary purification step

The C-terminal domain's high proline/glutamine content may cause aberrant migration on SDS-PAGE, so confirming identity by mass spectrometry is recommended.

What are the best approaches for studying Rv0954's role during infection?

Although current data doesn't suggest an essential role for Rv0954 in vitro, studying its function during infection requires specialized approaches:

  • Infection models:

    • Macrophage infection assays comparing wild-type and Δrv0954 strains

    • Animal models assessing bacterial burden and histopathology

    • Competitive index experiments co-infecting with wild-type and mutant strains

  • Stress conditions to test:

    • Acidic pH (mimicking phagosomal environment)

    • Nutrient limitation

    • Oxidative and nitrosative stress

    • Cell wall-targeting antibiotics at sub-MIC concentrations

  • Readouts to measure:

    • Bacterial replication rates

    • Morphological changes by electron microscopy

    • Transcriptional responses using RNA-seq

    • Changes in Rv0954 phosphorylation during infection

These approaches might reveal condition-specific phenotypes not observed under standard laboratory conditions.

How can researchers investigate the redundancy of Rv0954 with other divisome components?

To explore potential functional redundancy:

  • Generate multiple deletion strains:

    • Create double or triple knockouts with genes identified in Tnseq screens

    • Focus on combinations with PbpA, PerM, LamA, and other hits from genetic interaction studies

  • Conditional depletion systems:

    • For essential interacting genes, use CRISPRi or tetracycline-regulatable systems

    • Titrate expression levels to identify synthetic lethality thresholds

  • Domain swap experiments:

    • Replace domains of Rv0954 with corresponding regions from potential redundant proteins

    • Test if chimeric proteins can complement phenotypes in multiple deletion strains

  • Compensation analysis:

    • Examine if expression of other divisome components increases in Δrv0954

    • Use proteomics to identify upregulated proteins that might compensate for Rv0954 loss

These approaches could help define the network of proteins that collectively ensure robust cell division in mycobacteria.

What is the potential of Rv0954 as a drug target for tuberculosis treatment?

While Rv0954 is non-essential in vitro, its role in cell division and genetic interactions with essential genes suggest potential as a component of combination therapies:

  • Target evaluation criteria:

    • Conservation across mycobacterial species but absent in humans

    • Involvement in a critical process (cell division)

    • Potential synergies with existing antibiotics

  • Drug development approaches:

    • Structure-based design targeting protein-protein interactions

    • Screens for compounds that disrupt Rv0954 localization

    • Adjuvant potential: compounds that may not kill alone but sensitize to other antibiotics

  • Combination strategy rationale:

    • Targeting Rv0954 together with genetically interacting proteins like PbpA or PerM

    • Enhancing activity of cell wall-targeting antibiotics

    • Disrupting multiple components of the divisome simultaneously

The genetic interaction data suggests that inhibiting Rv0954 could weaken Mtb's ability to divide properly, particularly under stress conditions relevant to infection.

How might phosphorylation of Rv0954 be regulated during infection and stress?

Understanding the regulation of Rv0954 phosphorylation could reveal important insights into mycobacterial adaptation:

  • Potential regulatory mechanisms:

    • Stress-responsive activation of PknH kinase

    • Protein-protein interactions that expose or mask phosphorylation sites

    • Localization-dependent access to kinases/phosphatases

  • Experimental approaches:

    • Phospho-specific antibodies to track phosphorylation under various conditions

    • Phosphoproteomics across infection time points

    • Correlation of phosphorylation with changes in Rv0954 interaction partners

    • In vitro kinase assays with purified components to determine specificity

  • Functional consequences to investigate:

    • Effects on protein-protein interactions

    • Changes in divisome assembly/disassembly kinetics

    • Impact on mycobacterial dormancy or reactivation

The presence of multiple phosphorylation sites suggests complex regulation that may fine-tune Rv0954's function under different environmental conditions.

What controls should be included when studying Rv0954 localization?

When designing experiments to study Rv0954 localization, researchers should include these critical controls:

  • Expression level controls:

    • Native promoter versus inducible systems

    • Complementation with wild-type protein in knockout background

    • Western blot confirmation of expression levels

  • Fluorescent protein fusion controls:

    • Both N- and C-terminal fusions to ensure tag doesn't disrupt localization

    • Free fluorescent protein expression to distinguish specific from non-specific localization

    • Functional complementation assays to confirm fusion protein activity

  • Microscopy controls:

    • Co-imaging with established cell cycle markers (FtsZ, Wag31)

    • Membrane staining (FM5-95) to visualize cell boundaries

    • Z-stack imaging to capture the full three-dimensional localization

These controls help distinguish authentic localization patterns from artifacts caused by overexpression or tag interference.

How should researchers address the absence of phenotypes when studying Rv0954?

The lack of obvious phenotypes in Rv0954 deletion mutants presents a common challenge in studying proteins with redundant functions. Recommended approaches include:

  • Expand condition testing:

    • Examine growth under diverse stress conditions beyond standard media

    • Test cell division under nutrient limitation or other physiological stresses

    • Examine competitive fitness in mixed cultures

  • Increase sensitivity of assays:

    • Time-lapse microscopy to detect subtle changes in division timing or morphology

    • Single-cell analysis rather than population measurements

    • Fluorescent reporters for cell wall synthesis or chromosome segregation

  • Create sensitized genetic backgrounds:

    • Combine with mutations in genes identified by Tnseq (PbpA, PerM, LamA)

    • Use chemical inhibitors of cell division at sub-inhibitory concentrations

    • Deplete other divisome components using inducible systems

The most promising approach is focusing on genetic interactions identified through Tnseq, which revealed numerous potential functional partners that become more important in the absence of Rv0954.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.