Recombinant ABC transporter ATP-binding protein/permease wht-1 (wht-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please communicate it to us. We will prioritize fulfilling your request.
Synonyms
wht-1; C05D10.3; ABC transporter ATP-binding protein/permease wht-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
wht-1
Target Protein Sequence
MPKRRVKEILHNVSGMAESGKLLAILGSSGAGKTTLMNVLTSRNLTNLDVQGSILIDGRR ANKWKIREMSAFVQQHDMFVGTMTAREHLQFMARLRMGDQYYSDHERQLRVEQVLTQMGL KKCADTVIGIPNQLKGLSCGEKKRLSFASEILTCPKILFCDEPTSGLDAFMAGHVVQALR SLADNGMTVIITIHQPSSHVYSLFNNVCLMACGRVIYLGPGDQAVPLFEKCGYPCPAYYN PADHLIRTLAVIDSDRATSMKTISKIRQGFLSTDLGQSVLAIGNANKLRAASFVTGSDTS EKTKTFFNQDYNASFWTQFLALFWRSWLTVIRDPNLLSVRLLQILITAFITGIVFFQTPV TPATIISINGIMFNHIRNMNFMLQFPNVPVITAELPIVLRENANGVYRTSAYFLAKNIAE LPQYIILPILYNTIVYWMSGLYPNFWNYCFASLVTILITNVAISISYAVATIFANTDVAM TILPIFVVPIMAFGGFFITFDAIPSYFKWLSSLSYFKYGYEALAINEWDSIKVIPECFNS SMTAFALDSCPKNGHQVLESIDFSASHKIFDISILFGMFIGIRIIAYVALLIRSYNNT
Uniprot No.

Target Background

Function
Essential for efficient RNA interference (RNAi). Plays a crucial role in germline development.
Database Links

KEGG: cel:CELE_C05D10.3

STRING: 6239.C05D10.3

UniGene: Cel.10888

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the intestine in both larvae and adults. Expressed in the gut of males.

Q&A

What is WHT-1 and what are its key structural features?

WHT-1 is an ABC transporter ATP-binding protein/permease from Caenorhabditis elegans. The full-length protein consists of 598 amino acids and contains the characteristic nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, as well as transmembrane domains (TMDs) that form the substrate translocation pathway . Like other ABC transporters, WHT-1 likely undergoes conformational changes upon ATP binding and hydrolysis to facilitate substrate transport across cellular membranes. The protein belongs to the ABC transporter superfamily, which is one of the largest protein families and is present in all organisms from bacteria to humans.

How does WHT-1 compare to other ABC transporters in structure and function?

Functional DomainDescriptionRole in Transport
Nucleotide-binding domains (NBDs)Contain Walker A, Walker B, and signature motifsATP binding and hydrolysis
Transmembrane domains (TMDs)Membrane-spanning helicesSubstrate recognition and translocation pathway
Coupling helicesConnect NBDs to TMDsTransmit conformational changes

The evolutionary relationship between WHT-1 and other ABC transporters provides insights into potential functional similarities, though experimental validation is necessary to confirm substrate specificity.

What methodological approaches are typically used to express and purify WHT-1?

Recombinant expression of WHT-1 is typically performed in E. coli expression systems, with the protein commonly tagged with a histidine tag to facilitate purification . The general methodology involves:

  • Cloning the wht-1 gene into an appropriate expression vector

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Cell lysis and membrane protein solubilization using detergents

  • Affinity purification using the His-tag

  • Size exclusion chromatography for further purification

Researchers should be aware that membrane proteins like WHT-1 often present challenges during expression and purification due to their hydrophobic nature. Various detergents and stabilizing agents may need to be tested to maintain protein stability and functionality throughout the purification process.

How should I design experiments to assess WHT-1 ATP binding and hydrolysis?

A comprehensive experimental design should include:

  • Binding assays: Measure changes in TNP-ATP fluorescence upon binding to purified WHT-1

  • Competition assays: Use unlabeled ATP to compete with TNP-ATP to determine binding specificity

  • Mutational analysis: Generate WHT-1 variants with mutations in key ATP-binding residues

  • ATPase assays: Measure inorganic phosphate release to quantify ATP hydrolysis rates

  • Controls: Include non-ATP-binding proteins and thermally denatured WHT-1 as negative controls

What considerations should be made when designing functional transport assays for WHT-1?

Designing functional transport assays for WHT-1 requires careful consideration of the following methodological aspects:

  • Reconstitution system: WHT-1 should be reconstituted into liposomes or proteoliposomes with defined lipid composition to mimic its native membrane environment.

  • Substrate selection: Since the natural substrates of WHT-1 are not fully characterized, a range of potential substrates should be tested, informed by known substrates of related ABC transporters.

  • Transport measurement: Design assays that can detect substrate accumulation inside vesicles (for uptake transporters) or substrate efflux from vesicles (for efflux transporters).

  • Control conditions: Include ATP-free controls, non-hydrolyzable ATP analogs, and ATPase inhibitors to verify ATP-dependence of transport.

  • Time course measurements: Monitor transport over time to determine initial rates and achieve equilibrium.

When reporting your experimental design, clearly define your independent variable (e.g., substrate concentration, ATP concentration) and dependent variable (e.g., transport rate) . Document how you controlled for extraneous variables such as temperature, pH, and ionic strength, as these can significantly impact transporter function.

How can I investigate potential WHT-1 interacting partners in C. elegans?

Investigating WHT-1 interacting partners requires a multi-method approach:

  • Co-immunoprecipitation (Co-IP): Express tagged WHT-1 in C. elegans or heterologous systems and perform Co-IP followed by mass spectrometry to identify bound proteins.

  • Yeast two-hybrid (Y2H) screening: Although challenging for full-length membrane proteins, modified Y2H systems or using soluble domains of WHT-1 can identify potential interactors.

  • Proximity labeling: Express WHT-1 fused to enzymes like BioID or APEX2 in C. elegans to biotinylate nearby proteins, which can then be purified and identified.

  • Genetic interaction screens: Use RNAi or CRISPR-based screens to identify genes that modify WHT-1 mutant phenotypes.

  • In vivo co-localization: Perform fluorescence microscopy to identify proteins that co-localize with WHT-1 in tissues of interest.

For each method, appropriate controls must be included to distinguish specific from non-specific interactions. Consider the biological relevance of identified interactions by assessing co-expression patterns and functional relationships.

What approaches can be used to study the structure-function relationship of WHT-1?

Studying the structure-function relationship of WHT-1 requires an integrated approach combining structural biology, biochemical analysis, and functional assays:

  • Homology modeling: Develop structural models based on related ABC transporters with known structures.

  • Site-directed mutagenesis: Systematically mutate conserved residues in:

    • ATP-binding motifs (Walker A, Walker B, signature motif)

    • Transmembrane domains

    • Predicted substrate-binding pockets

    • Interface regions between domains

  • Functional characterization of mutants: Assess how mutations affect:

    • ATP binding and hydrolysis rates

    • Substrate binding affinity

    • Transport activity

    • Conformational changes

  • Structural studies: Attempt X-ray crystallography or cryo-electron microscopy of WHT-1, though these techniques present challenges for membrane proteins.

  • Crosslinking and accessibility studies: Use chemical crosslinking and cysteine accessibility methods to probe conformational changes and domain interactions.

A comprehensive structure-function analysis should systematically correlate structural features with specific functional aspects, allowing for the development of a mechanistic model of WHT-1 transport activity.

How should I analyze and interpret kinetic data from WHT-1 ATP hydrolysis assays?

Analysis of kinetic data from WHT-1 ATP hydrolysis assays should follow these methodological steps:

  • Michaelis-Menten analysis: Plot initial velocity (V₀) versus substrate concentration [S] and fit to the Michaelis-Menten equation:

    V0=Vmax×[S]Km+[S]V_0 = \frac{V_{max} \times [S]}{K_m + [S]}

  • Determine key kinetic parameters:

    • V<sub>max</sub> (maximum velocity)

    • K<sub>m</sub> (Michaelis constant, representing substrate concentration at half-maximal velocity)

    • k<sub>cat</sub> (turnover number, calculated as V<sub>max</sub>/[Enzyme])

    • k<sub>cat</sub>/K<sub>m</sub> (catalytic efficiency)

  • Evaluate inhibition patterns: For inhibitor studies, determine the inhibition type (competitive, non-competitive, uncompetitive) by analyzing how K<sub>m</sub> and V<sub>max</sub> are affected.

  • Statistical analysis: Apply appropriate statistical tests to compare parameters between wild-type and mutant WHT-1 or between different experimental conditions .

  • Address data complexities: Consider factors such as substrate cooperativity, multiple binding sites, or transport-coupled conformational changes that may cause deviations from simple Michaelis-Menten kinetics.

When interpreting results, consider that ATP hydrolysis may not be directly coupled to transport in a 1:1 ratio, and that basal ATPase activity (in the absence of transport substrate) is common in ABC transporters.

What role does WHT-1 play in C. elegans lipid homeostasis and how can this be investigated?

Based on functional similarities with human ABCG1, which is involved in cellular lipid homeostasis , WHT-1 may play a role in C. elegans lipid transport and metabolism. To investigate this role:

  • Lipid profiling: Compare lipid compositions in wild-type versus wht-1 knockout C. elegans using lipidomics approaches.

  • Tissue-specific expression analysis: Determine where WHT-1 is expressed using reporter constructs or immunohistochemistry, focusing on tissues involved in lipid metabolism.

  • Phenotypic characterization: Assess wht-1 mutants for phenotypes related to lipid homeostasis:

    • Fat storage (using Oil Red O or Nile Red staining)

    • Response to dietary lipid modifications

    • Resistance to lipotoxicity

    • Lifespan and healthspan metrics

  • Rescue experiments: Test whether human ABCG1 can rescue wht-1 mutant phenotypes to assess functional conservation.

  • Transport assays: Develop in vitro assays using purified WHT-1 to test transport of specific lipid species.

Design your experiments with appropriate controls and consider potential interactions with other lipid transport systems. Use statistical approaches that account for biological variability and potential confounding factors .

What fluorescent probes and techniques can be used to study WHT-1 ATP binding dynamics?

Several fluorescent probes and techniques can be employed to study WHT-1 ATP binding dynamics:

When designing these experiments, consider:

  • Protein-to-probe ratio optimization

  • Environmental factors (pH, ionic strength, temperature)

  • Potential interference from detergents or lipids

  • Appropriate negative controls (non-binding mutants)

How can I optimize purification protocols for recombinant WHT-1?

Optimizing purification protocols for recombinant WHT-1 requires addressing several key aspects of membrane protein biochemistry:

  • Expression system selection:

    • E. coli is commonly used but may not always provide optimal folding

    • Consider insect cells or yeast for eukaryotic post-translational modifications

    • Cell-free systems may be useful for difficult-to-express constructs

  • Solubilization strategy:

    Detergent ClassExamplesBenefitsLimitations
    Mild non-ionicDDM, LMNGGood for maintaining structureMay not fully solubilize
    ZwitterionicCHAPS, Fos-cholineEffective solubilizationCan be more denaturing
    Steroid-basedDigitonin, GDNGood for complex proteinsExpensive, variable quality
    AmphipolsA8-35, PMALStabilize in detergent-free solutionNot for extraction
  • Purification approach:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged WHT-1

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

    • Affinity chromatography with specific ligands if available

  • Stability enhancement:

    • Screen stabilizing additives (glycerol, specific lipids, cholesterol)

    • Consider nanodiscs or liposomes for reconstitution

    • Test thermostabilizing mutations if functional studies permit

  • Quality control:

    • Size exclusion chromatography to assess monodispersity

    • Circular dichroism to confirm secondary structure

    • ATPase activity assays to verify functionality

Systematic optimization of these parameters will maximize the yield of functional WHT-1 protein suitable for downstream applications.

What are the challenges and solutions in measuring transport activity of reconstituted WHT-1?

Measuring transport activity of reconstituted WHT-1 presents several methodological challenges:

  • Reconstitution challenges:

    • Controlling protein orientation in liposomes

    • Achieving consistent protein-to-lipid ratios

    • Maintaining protein stability during reconstitution

    Solutions: Optimize reconstitution using different methods (detergent dialysis, direct incorporation), lipid compositions, and buffer conditions. Validate reconstitution efficiency using freeze-fracture electron microscopy or protease protection assays.

  • Substrate identification:

    • Unknown natural substrates for WHT-1

    • Potential low affinity or specificity

    Solutions: Screen potential substrates based on related transporters. Use radiolabeled or fluorescently labeled substrate analogs. Consider untargeted approaches to identify transported molecules.

  • Signal-to-noise ratio:

    • Low transport rates

    • High background permeability for some substrates

    Solutions: Increase protein density in liposomes. Use substrates with minimal passive diffusion. Employ sensitive detection methods (radioisotopes, fluorescence quenching).

  • ATP delivery:

    • Ensuring ATP accessibility to the nucleotide-binding domains

    • Controlling ATP concentration during the experiment

    Solutions: Add ionophores to ensure equal ion distribution. Use ATP-regenerating systems for long experiments. Include magnesium for optimal ATPase activity.

  • Data interpretation:

    • Distinguishing active transport from passive diffusion

    • Accounting for vesicle heterogeneity

    Solutions: Include ATP-free controls and use ATPase inhibitors. Normalize transport data to vesicle volume using internal volume markers.

By systematically addressing these challenges, researchers can develop robust assays for WHT-1 transport activity characterization.

How should researchers design Table 1 in publications to effectively describe WHT-1 studies?

When designing Table 1 for publications on WHT-1 studies, researchers should follow these guidelines to maximize transparency and aid in assessing both internal and external validity :

  • Basic structure:

    • Include a total column showing descriptive statistics for the entire study sample

    • For categorical variables, present n (%)

    • For continuous variables, present mean (standard deviation) or median (25th-75th percentile)

  • Column stratification:

    • For experimental studies, stratify by experimental groups (e.g., wild-type vs. mutant WHT-1)

    • For cohort studies, stratify by exposure (e.g., different substrate conditions)

    • Include p-values for comparisons between groups

  • Row organization:

    • Group variables by category (demographic, biochemical, functional)

    • Include all variables used in the main analysis

    • Present key outcome variables

  • Specific to WHT-1 research:

    • Include protein expression levels

    • Report purification yields

    • Present basal and substrate-stimulated ATPase activities

    • Show transport rates for tested substrates

  • Handling analytical complexities:

    • For studies with missing data, indicate the number of observations for each variable

    • For interaction analyses, consider showing distributions according to strata of both the exposure and modifier

How can I resolve contradictory data in WHT-1 functional studies?

Resolving contradictory data in WHT-1 functional studies requires a systematic approach:

  • Methodological reconciliation:

    • Compare experimental conditions (buffer composition, pH, temperature)

    • Assess differences in protein preparation (expression system, purification method)

    • Evaluate reconstitution approaches (lipid composition, protein-to-lipid ratio)

    • Consider detection method sensitivity and specificity

  • Biological explanations:

    • Investigate protein isoforms or post-translational modifications

    • Consider the presence of endogenous regulators or inhibitors

    • Examine construct differences (tags, truncations, mutations)

    • Assess the impact of different lipid environments

  • Statistical approaches:

    • Perform meta-analysis of available data when possible

    • Use more sophisticated statistical models to account for covariates

    • Consider Bayesian approaches to incorporate prior knowledge

  • Validation experiments:

    • Design experiments that directly test conflicting results

    • Use orthogonal techniques to verify findings

    • Collaborate with groups reporting contradictory results

  • Reporting recommendations:

    • Transparently report all experimental conditions

    • Discuss possible reasons for contradictions

    • Present both supportive and contradictory evidence

    • Suggest experimental approaches to resolve discrepancies

Remember that contradictions in the literature may reflect true biological complexity rather than experimental error, and elucidating these complexities can lead to important new insights about WHT-1 function.

What are the best approaches for comparing wild-type and mutant WHT-1 in functional studies?

When comparing wild-type and mutant WHT-1 in functional studies, employ these methodological approaches:

  • Experimental design considerations:

    • Use paired designs when possible to reduce variability

    • Express and purify wild-type and mutant proteins in parallel

    • Perform assays under identical conditions

    • Include appropriate positive and negative controls

  • Parameters to compare:

    • Expression levels and stability

    • ATP binding affinity (K<sub>d</sub>)

    • ATPase activity (V<sub>max</sub>, K<sub>m</sub>, k<sub>cat</sub>)

    • Substrate binding and transport rates

    • Conformational changes upon ATP/substrate binding

  • Statistical analysis:

    • Use appropriate statistical tests based on data distribution

    • Apply corrections for multiple comparisons

    • Report effect sizes along with p-values

    • Consider hierarchical or mixed models for complex designs

  • Interpretation frameworks:

    • Relate functional changes to structural alterations

    • Consider whether mutations affect ATP binding, hydrolysis, or coupling to transport

    • Assess whether mutations alter substrate specificity or just transport efficiency

    • Compare results to effects of similar mutations in related transporters

  • Complementary approaches:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use structural biology techniques to visualize mutation effects

    • Employ molecular dynamics simulations to predict impact on protein dynamics

By systematically comparing multiple functional parameters between wild-type and mutant WHT-1, researchers can develop mechanistic models of how specific residues or domains contribute to transporter function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.