Recombinant Abyssocottus korotneffi Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Production and Purification

This recombinant protein is produced via heterologous expression systems, with E. coli being the most frequently used host . Key production parameters include:

  • Expression Region: Full-length (1–289 amino acids) .

  • Storage Buffer: Tris/PBS-based buffer with 6% trehalose or 50% glycerol .

  • Storage Conditions:

    • Long-term: -20°C or -80°C.

    • Working Aliquots: 4°C for ≤1 week .

Purification Notes:

  • Low Endotoxin Option: Available upon request .

  • Freezing/Thawing: Repeated cycles are discouraged to preserve stability .

Spectral Tuning and Thermal Noise Modulation

Studies using quantum mechanics/molecular mechanics (QM/MM) models reveal that A. korotneffi rhodopsin’s blue-shifted λ<sub>max</sub> (484 nm for A2 chromophore) is critical for reducing thermal noise in abyssal environments . Key findings:

  • Activation Energy (E<sub>a</sub>T):

    • A. korotneffi rhodopsin exhibits a 5.4 kcal/mol higher E<sub>a</sub>T compared to red-shifted littoral species (e.g., P. kneri), minimizing spontaneous isomerization .

    • Cavity Substitutions: Directly influence ΔE (excitation energy difference) and E<sub>a</sub>T. For example, Y261F substitution increases E<sub>a</sub>T by stabilizing the transition state .

SpeciesHabitatλ<sub>max</sub> (A2)E<sub>a</sub>TKey Substitutions
A. korotneffiAbyssal484 nmHighY261F, A292S, G114A (cavity)
P. kneriLittoralRed-shiftedLowNone (reference)

Ecological Adaptation

  • Chromophore Diversity: Freshwater fish like A. korotneffi predominantly use 3-dehydroretinal (A2), whereas marine species rely on retinal (A1) .

  • Protein Dynamics: Extra-cavity substitutions (e.g., T297S, D83N) indirectly modulate spectral sensitivity by altering the chromophore’s hydrogen-bond network (HBN) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Abyssocottus korotneffi (Baikalian deep-water sculpin)
Target Names
rho
Target Protein Sequence
YLVNPAAYAALGAYMFLLILIGFPINFLTLYVTLEHKKLRTPLNYILLNLAVANLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEAFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFTWVMALACAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAPAAQQESETTQRAEKEVSRMVVIMVIGFLVCWLPYA SVAWWIFCNQGSDFGPIFMTLPSFFAKSAAIYNPMIYICMNKQFRHCMI
Uniprot No.

Target Background

Function

Recombinant Abyssocottus korotneffi Rhodopsin (rho) is a photoreceptor essential for low-light vision. While most marine fish utilize retinal as a chromophore, freshwater species often use 3-dehydroretinal, or a mixture of both. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating G-protein signaling. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signal transduction cascade.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Abyssocottus korotneffi and why is its rhodopsin of interest to researchers?

Abyssocottus korotneffi is a species of ray-finned fish belonging to the family Cottidae (typical sculpins), endemic to Lake Baikal in Russia. This deep-water species inhabits depth ranges of 120-1,600 meters, most commonly found between 460-500 meters . The rhodopsin from this species is of particular scientific interest because it represents an adaptation to deep-water environments with limited light penetration. Cottoid fishes in Lake Baikal show a gradual blue-shift in the wavelength of absorption maximum of their visual pigments correlating with increasing habitat depth . This makes A. korotneffi rhodopsin an excellent model for studying visual adaptations to extreme environments.

How does recombinant A. korotneffi rhodopsin differ from native rhodopsin?

Recombinant A. korotneffi rhodopsin is produced in expression systems rather than extracted directly from the fish. While the amino acid sequence is identical to the native protein, recombinant versions may contain additional features:

FeatureNative RhodopsinRecombinant Rhodopsin
TagsNoneMay include purification tags (His, GST, etc.)
GlycosylationNative patternMay differ depending on expression system
Lipid environmentNatural cell membraneTypically reconstituted in detergent or artificial lipids
Chromophore11-cis-retinal (A1/A2)Often requires exogenous addition of chromophore

The tag type for commercial recombinant A. korotneffi rhodopsin is typically determined during the production process and optimized for the specific protein .

What are the optimal storage conditions for recombinant A. korotneffi rhodopsin?

Recombinant A. korotneffi rhodopsin requires careful handling to maintain its structural integrity and functionality. The recommended storage conditions are:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Repeated freezing and thawing is not recommended

  • Working aliquots may be stored at 4°C for up to one week

These conditions help preserve the rhodopsin's native conformation and functional properties for experimental use.

How can researchers functionally characterize recombinant A. korotneffi rhodopsin in vitro?

Functional characterization of recombinant A. korotneffi rhodopsin can be approached through several complementary methods:

  • Spectroscopic Analysis: UV-visible absorption spectroscopy to determine the rhodopsin's absorption maximum and spectral properties. This is particularly important as Baikal cottoid fishes show a blue-shift in absorption maxima correlated with habitat depth .

  • Thermal Stability Assays: Measuring the rate of thermal isomerization to assess the relationship between absorption maxima and thermal noise, which is crucial for understanding deep-water visual adaptations .

  • Electrophysiological Studies: Patch-clamp or other electrophysiological techniques to assess the protein's response to light stimuli.

  • G-protein Activation Assays: In vitro assessment of the rhodopsin's ability to activate appropriate G-proteins in response to light.

  • Chromophore Regeneration Kinetics: Measuring the rate of chromophore regeneration after photobleaching to understand the visual cycle dynamics.

These methods can provide comprehensive insights into the functional properties of A. korotneffi rhodopsin and its adaptations to deep-water environments.

What expression systems are most suitable for producing functional recombinant A. korotneffi rhodopsin?

The choice of expression system significantly impacts the yield and functionality of recombinant rhodopsin:

Expression SystemAdvantagesChallengesRecommendations
Mammalian Cells (HEK293, COS)Proper folding and post-translational modificationsLower yield, higher costPreferred for functional studies requiring native-like structure
Insect Cells (Sf9, Hi5)Higher yield than mammalian, good foldingMedium cost, complex culture requirementsGood balance of yield and functionality
Yeast (P. pastoris)High yield, eukaryotic processingMay have glycosylation differencesSuitable for structural studies with optimization
E. coliHighest yield, lowest costOften forms inclusion bodies, lacks post-translational modificationsRequires refolding protocols, limited functionality

For optimal functional analysis, mammalian or insect cell expression systems are recommended despite their higher cost and complexity.

How does the spectral tuning of A. korotneffi rhodopsin relate to its deep-water habitat?

The rhodopsin of A. korotneffi exhibits spectral properties adapted to its deep-water environment in Lake Baikal. Research shows that cottoid fishes in Lake Baikal display a gradual blue-shift in the wavelength of absorption maximum (λmax) of their visual pigments with increasing habitat depth .

A. korotneffi typically inhabits depths of 460-500 meters, with a range extending to 1,600 meters . At these depths, only blue light penetrates the water column, making blue-shifted rhodopsin advantageous for detecting the limited available light. This spectral tuning is achieved through specific amino acid substitutions in the retinal-binding pocket that modify the electronic environment around the chromophore.

Quantum chemical calculations combined with homology modeling have been able to reproduce the trend of observed absorption maxima in both A1 and A2 rhodopsins of Baikal cottoid fishes, confirming the relationship between habitat depth and spectral properties .

What is the relationship between thermal noise and spectral tuning in A. korotneffi rhodopsin?

A significant finding in rhodopsin research is the Barlow-type relationship between absorption maxima and thermal isomerization rate in visual pigments. For A. korotneffi and other Baikal cottoid fishes, research has revealed a link between the observed blue-shift in absorption maxima and decreased thermal noise .

This relationship is critical for deep-water vision because:

  • Thermal noise (spontaneous isomerization of the chromophore in the absence of light) creates "false positive" signals that can interfere with detection of genuine light stimuli.

  • In extremely low-light environments like deep Lake Baikal, minimizing thermal noise is essential for effective vision.

  • The blue-shifted absorption maximum in A. korotneffi rhodopsin appears to be an adaptation that simultaneously optimizes spectral sensitivity for available light wavelengths and reduces thermal noise.

Electrostatic effects of both conserved and non-conserved amino acid residues surrounding the rhodopsin chromophore modulate both thermal noise and spectral properties simultaneously , representing a sophisticated evolutionary adaptation to deep-water environments.

How does A. korotneffi rhodopsin compare to rhodopsins from other deep-sea organisms?

Comparative analysis of A. korotneffi rhodopsin with other deep-sea visual pigments reveals convergent adaptations across phylogenetically distant organisms:

Organism TypeHabitat DepthAbsorption Maximum (λmax)Thermal NoiseKey Adaptations
A. korotneffi (Lake Baikal cottoid)460-1600mBlue-shiftedReducedSpecific amino acid substitutions in binding pocket
Deep-sea teleosts (marine)>1000m470-480nmVery lowAmino acid substitutions at positions 83, 122, 261
Deep-sea cephalopods>500m470-490nmReducedConvergent substitutions in binding pocket

While both marine deep-sea organisms and Lake Baikal cottoids show blue-shifted rhodopsins, the specific molecular mechanisms may differ due to their independent evolutionary histories. The Lake Baikal cottoid radiation is relatively recent compared to marine deep-sea adaptations, making A. korotneffi an excellent model for studying the early stages of visual adaptation to deep environments .

What evidence exists regarding the evolutionary origin of A. korotneffi rhodopsin?

A. korotneffi belongs to a recent radiation of cottoid fishes in Lake Baikal, which provides an excellent system for studying the evolution of visual pigments . Phylogenetic studies have found that Baikal sculpins (including those classified in the subfamilies Comephorinae and Abyssocottinae) likely radiated from an ancestor within the genus Cottus .

This suggests that the adaptation of A. korotneffi rhodopsin to deep-water environments occurred relatively recently in evolutionary terms. The rhodopsin gene (rho) is highly conserved across vertebrates, which allows for robust phylogenetic comparisons .

What molecular techniques are most effective for studying evolutionary aspects of A. korotneffi rhodopsin?

Researchers investigating the evolutionary aspects of A. korotneffi rhodopsin employ several complementary approaches:

  • Comparative Genomics: Sequencing and comparing the rhodopsin genes from different Baikal cottoid species at various habitat depths to identify correlation between genetic variants and depth adaptation.

  • Site-Directed Mutagenesis: Creating targeted mutations in the rhodopsin sequence to test the functional impact of specific amino acid residues thought to be involved in spectral tuning or thermal noise regulation.

  • Ancestral Sequence Reconstruction: Computational inference of ancestral rhodopsin sequences in the cottoid lineage to track the evolutionary trajectory of adaptive changes.

  • Heterologous Expression and Functional Characterization: Expressing both modern and reconstructed ancestral sequences in cell systems to measure their spectral and biochemical properties.

  • Quantum Chemical Calculations: Modeling the effects of amino acid substitutions on the electronic structure of the retinal chromophore to predict and explain spectral shifts .

These approaches together provide a comprehensive understanding of the molecular evolution of rhodopsin in response to the selective pressures of deep-water environments.

How can researchers distinguish between convergent evolution and homology in rhodopsin studies?

Distinguishing between convergent evolution and homology in rhodopsins represents one of the most intractable problems in molecular evolution . For researchers studying A. korotneffi rhodopsin, several approaches can help address this question:

  • Experimental Protein Engineering: Engineering functional rhodopsin variants with novel folds, including radical permutations of the α-helices and relocated retinal linkages, can test whether the fold is required for photosensitive activity. Recent research has shown that the rhodopsin fold is not absolutely required for function, which challenges a key prediction of convergence theory .

  • Deep Phylogenetic Analysis: Using advanced phylogenetic methods that can detect distant homology beyond the limitations of standard sequence comparison approaches.

  • Structural Bioinformatics: Detailed comparison of three-dimensional structures and functional sites rather than relying solely on primary sequence similarity.

  • Analysis of Genetic Mechanisms: Investigating the genetic and developmental pathways involved in rhodopsin expression and function to identify shared regulatory mechanisms that might indicate common ancestry.

  • Molecular Evolution Rates: Comparing the rates of evolution in different lineages and correlating them with environmental transitions, such as adaptation to deep-water habitats.

These approaches can provide evidence to evaluate whether similar structures in different lineages resulted from common ancestry (homology) or independent adaptations to similar selective pressures (convergence).

What are the main technical challenges in expressing and purifying functional recombinant A. korotneffi rhodopsin?

Researchers face several significant challenges when working with recombinant A. korotneffi rhodopsin:

  • Membrane Protein Expression: As a seven-transmembrane protein, rhodopsin is difficult to express in heterologous systems while maintaining proper folding and membrane insertion.

  • Chromophore Integration: Ensuring proper covalent attachment of the retinal chromophore via the Schiff base linkage to the conserved lysine residue is essential for functionality.

  • Protein Stability: Rhodopsins can be unstable when removed from their native membrane environment, requiring careful optimization of detergents or lipid environments.

  • Light Sensitivity: Once the chromophore is attached, the protein becomes light-sensitive and requires handling under dim red light conditions to prevent unintended activation.

  • Functional Assays: Developing reliable assays to measure the spectral and functional properties of the rhodopsin in vitro.

Methodological approaches to address these challenges include:

  • Use of specialized expression vectors with optimal signal sequences

  • Expression in the dark or under red light conditions

  • Addition of stabilizing agents during purification

  • Reconstitution into nanodiscs or liposomes to provide a more native-like lipid environment

  • Use of detergents specifically optimized for rhodopsin stability

How can researchers effectively study the electrostatic effects of amino acid residues on A. korotneffi rhodopsin function?

The electrostatic environment around the chromophore is crucial for both spectral tuning and thermal noise properties of rhodopsin. Researchers can investigate these effects through:

  • Nakanishi Point-Charge Analysis: This computational approach has successfully identified both close and distant sites affecting spectral tuning and visual sensitivity in Baikal cottoid visual pigments . The method analyzes how the charges of amino acid residues influence the electronic structure of the retinal chromophore.

  • Site-Directed Mutagenesis: Systematically replacing specific amino acid residues and measuring the effects on absorption spectra and thermal isomerization rates.

  • Quantum Mechanical/Molecular Mechanical (QM/MM) Calculations: These hybrid computational methods can model the interactions between the chromophore (treated quantum mechanically) and the surrounding protein environment (treated with molecular mechanics).

  • FTIR Difference Spectroscopy: This technique can identify changes in protein-chromophore interactions upon light activation, providing insights into the role of specific residues.

  • Homology Modeling Combined with Electrostatic Calculations: Creating structural models of A. korotneffi rhodopsin based on known rhodopsin structures, then calculating the electrostatic potential around the chromophore.

These approaches have revealed that natural variation at specific sites modulates both thermal noise and spectral shifting in Baikal cottoid visual pigments, resulting in adaptations enabling vision in deep-water light environments .

What experimental designs are most effective for studying the relationship between thermal noise and spectral tuning in A. korotneffi rhodopsin?

To effectively study the relationship between thermal noise and spectral tuning, researchers should consider the following experimental designs:

  • Temperature-Controlled Absorption Spectroscopy: Measuring absorption spectra at different temperatures to determine the thermal stability of the dark state and the activation energy for thermal isomerization.

  • Dark Noise Electrophysiological Recordings: Using electrophysiological techniques to measure spontaneous activation events in the absence of light at different temperatures.

  • Comparative Analysis: Expressing rhodopsins from A. korotneffi alongside those from related species inhabiting different depths in Lake Baikal to directly compare their spectral and thermal properties.

  • Mutagenesis Studies: Creating a series of mutants with substitutions at key positions identified by computational analysis to independently manipulate spectral tuning and thermal stability.

  • Combined Experimental and Computational Approach: Validating computational predictions about the effects of specific substitutions through experimental measurements of both absorption maxima and thermal isomerization rates.

A particularly powerful approach is to use a matrix experimental design, where multiple variables (temperature, pH, ion concentration) are systematically varied while measuring both spectral properties and thermal activation rates, allowing for multidimensional analysis of the relationship between these properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.