Recombinant Acanthamoeba castellanii ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Acanthamoeba castellanii ATP synthase subunit a (ATP6) is a mitochondrial protein critical for the function of ATP synthase (Complex V), the enzyme responsible for ATP production in oxidative phosphorylation. This subunit, encoded by the nuclear genome in A. castellanii, is part of the membrane-embedded Fo_o domain, which facilitates proton translocation to drive ATP synthesis . Recombinant ATP6 enables detailed biochemical and structural studies of mitochondrial energy production in this pathogenic amoeba, which is linked to infections such as granulomatous amebic encephalitis.

2.1. Protein Overview

  • Gene: ATP6 (nuclear-encoded in A. castellanii) .

  • UniProt ID: Q37385 .

  • Sequence: 247 amino acids (residues 1–247), with a molecular weight of ~26 kDa .

  • Domains:

    • Four transmembrane α-helices (predicted via homology to yeast and human ATP6) .

    • Conserved proton translocation pathways involving arginine residues (e.g., Arg-169, Arg-173 in yeast homologs) .

Table 1: Key Molecular Features of Recombinant ATP6

FeatureDetails
Expression SystemRecombinant production (host unspecified)
TagDetermined during production (commonly His or GST tags for purification)
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C/-80°C; avoid freeze-thaw cycles
Sequence MotifsMIFNPLEQFRISVLQKLFFGNIDISITNNTIILFVILIGFTFLFYVNYSTNTYIPSKWQY... (full N-terminal sequence available)

3.1. Role in ATP Synthase Assembly and Function

  • Fo_o Domain Composition: ATP6 forms part of the Fo_o proton channel alongside subunit 8 (A6L) and a c-subunit ring .

  • Proton Translocation: Mutations in ATP6 homologs (e.g., human MT-ATP6) disrupt proton flow, impairing ATP synthesis .

  • Structural Insights: Cryo-EM studies of yeast homologs reveal ATP6’s interaction with subunit 8 and the c-ring, stabilizing the Fo_o stator .

3.2. A. castellanii-Specific Studies

  • Complex V Architecture: BN-PAGE and MS/MS analyses identified ATP6 in two ATP synthase complexes (940 kDa and 820 kDa), suggesting dynamic assembly states .

  • Evolutionary Conservation: ATP6 in A. castellanii shares homology with mitochondrial carriers (e.g., Tim17/Tim22/Tim23 family) but lacks bacterial Fo_o subunit b, indicating divergent evolution .

Table 2: Functional Insights from A. castellanii ATP Synthase Studies

ParameterFindings
BN-PAGE AnalysisATP synthase exists as 940 kDa (holo-complex) and 820 kDa (subcomplex) .
Subunit InteractionATP6 associates with B14.7 (Tim17/Tim22 homolog) in the membrane arm .
Proteomic DetectionDetected in mitochondrial fractions via high-resolution MS/MS .

Applications of Recombinant ATP6

  • Drug Target Screening: ATP synthase inhibitors (e.g., oligomycin) target the Fo_o domain, and recombinant ATP6 enables inhibitor-binding assays .

  • Pathogenicity Studies: A. castellanii mitochondrial dysfunction linked to ATP6 mutations could inform therapies for amoebic infections .

  • Structural Biology: Supports cryo-EM and X-ray crystallography to resolve proton channel mechanisms .

Challenges and Future Directions

  • Expression Yield: Recombinant ATP6 production in E. coli or yeast may require optimization due to hydrophobicity .

  • Functional Assays: Development of proton translocation assays specific to A. castellanii ATP6 is needed .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. If you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Acanthamoeba castellanii (Amoeba)
Target Names
ATP6
Target Protein Sequence
MIFNPLEQFRISVLQKLFFGNIDISITNNTIILFVILIGFTFLFYVNYSTNTYIPSKWQY AVENIYLFVLQLFKQQINNIVALKYFPLVLFVFSFILFANLIGLLPYGFTITGHIIFTFQ IAFSLFFGITLINFFNNKTEFFNLFVPSGVPKPLIPFLVVIEVVSYLIRPFSLSVRLFAN MLAGHTLLNILSAFIFNVFKKYALISFLPLLFIVFIIVLEFCIAIVQAYIFSILTCIYLN DIYNTSH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Acanthamoeba castellanii ATP6?

ATP synthase subunit a (ATP6) in A. castellanii is an α-helical protein embedded within the inner mitochondrial membrane that functions as part of the F₀ component (proton pump) of the F₀F₁ ATP synthase complex. It plays a crucial role in the proton transport mechanism essential for oxidative phosphorylation . The protein consists of 247 amino acids with a molecular weight of approximately 28 kDa and is encoded by the mitochondrial genome .

The primary function of ATP6 is to form the proton channel with the c-ring, allowing protons to flow through the membrane, which drives the rotation of the ATP synthase and enables ATP production. The protein contains transmembrane domains that span the inner mitochondrial membrane and interacts closely with the c-ring .

What are the optimal conditions for expressing recombinant A. castellanii ATP6?

For successful expression of recombinant A. castellanii ATP6, the following methodology has proven effective:

  • Expression System: E. coli is the preferred host for expression of recombinant ATP6, specifically optimized E. coli strains for membrane protein expression .

  • Expression Vector: Use vectors with strong inducible promoters (such as T7 promoter) and appropriate fusion tags (N-terminal His-tag) to facilitate purification .

  • Culture Conditions: Optimal growth at 37°C until reaching OD₆₀₀ of 0.6-0.8, followed by induction with IPTG (0.2-0.5 mM) and continued growth at a lower temperature (16-18°C) for 16-20 hours to enhance proper folding.

  • Buffer Composition: For membrane proteins like ATP6, inclusion of mild detergents during cell lysis and protein extraction is essential. Typically, extraction buffers contain 20-50 mM Tris-HCl (pH 7.5-8.0), 100-300 mM NaCl, and detergents such as n-dodecyl β-D-maltoside (DDM) or Triton X-100.

  • Protein Stability: Addition of glycerol (5-10%) to storage buffers enhances stability of the purified protein .

What purification strategies yield the highest purity of recombinant ATP6?

A multi-step purification approach is recommended for obtaining high-purity recombinant ATP6:

  • Affinity Chromatography: Utilize His-tag affinity purification as the initial capture step. Nickel or cobalt resin columns effectively bind the His-tagged ATP6 .

  • Buffer Optimization: Purification in Tris/PBS-based buffer, pH 8.0, with 6% trehalose has been reported to yield stable protein .

  • Size Exclusion Chromatography: Following affinity purification, employ size exclusion chromatography to remove aggregates and achieve >90% purity.

  • Storage Conditions: Store purified protein in aliquots at -20°C/-80°C with 5-50% glycerol to prevent freeze-thaw damage .

  • Reconstitution Recommendations: When reconstituting freeze-dried protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL, and add glycerol to a final concentration of 50% for long-term storage .

How can the enzymatic activity of recombinant A. castellanii ATP6 be assessed in vitro?

Assessing the enzymatic activity of recombinant ATP6 requires functional incorporation into proteoliposomes to reconstitute the complete ATP synthase complex. The following methodologies can be employed:

  • Proteoliposome Reconstitution:

    • Incorporate purified ATP6 along with other ATP synthase subunits into liposomes composed of phospholipids (such as DOPC, DOPE, cardiolipin)

    • Detergent removal methods include dialysis, Bio-Beads, or gel filtration

  • ATP Synthesis Assay:

    • Generate a proton gradient across the liposome membrane using acid-base transitions or potassium/valinomycin systems

    • Measure ATP production using luciferase-based luminescence assays or coupled enzyme assays

  • Proton Translocation Measurement:

    • Monitor proton pumping activity using pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Quantify membrane potential generation with voltage-sensitive dyes (oxonol, DiSC3)

  • Inhibitor Studies:

    • Use specific inhibitors like oligomycin, DCCD, or venturicidin to confirm ATP synthase-specific activity

    • Compare activity with and without inhibitors to determine specificity

Similar assays performed with ATP synthase from E. callanderi demonstrated Na⁺-dependent ATP synthesis with half-maximal activity achieved at 0.57 mM Na⁺ . Activity was inhibited by N,N′-dicyclohexylcarbodiimide (DCCD), which competes with Na⁺ for binding sites in subunit c .

What role does A. castellanii ATP6 play in the organism's bioenergetic adaptability?

A. castellanii exhibits remarkable bioenergetic flexibility, and ATP6 plays a central role in this adaptability:

  • Dual Energy Production Systems: A. castellanii possesses both aerobic and anaerobic ATP generation pathways. ATP6 functions in the classical F₁F₀ ATP synthase for aerobic ATP production under normal oxygen conditions .

  • Adaptation to Oxygen Fluctuations: Experiments with oxygen depletion demonstrate that A. castellanii trophozoites primarily rely on oxygen for normal functioning, with lipids being their preferred substrate for energy production . When oxygen becomes limited, the organism can potentially shift to alternative energy production mechanisms.

  • Hydrogenosomal-Type Pathway: Evidence suggests A. castellanii contains a set of enzymes that could enable a hydrogenosomal type of anaerobic ATP generation, allowing its mitochondria to toggle between aerobic and anaerobic metabolism . ATP6 may play different roles in these transitions.

  • Metabolic Substrate Utilization: A. castellanii can utilize various substrates including:

    SubstrateCarbon Dioxide ProductionATP Production EstimationSubstrate Incorporation
    D-glucose7.4 (±1.6)2224.0 (±0.3)
    Octanoic acid150.8 (±42.4)75508.3 (±4.2)
    Oleic acid---

    Values show substrate degradation to CO₂ and incorporation in nmol/10⁶ cells/h; ATP production in pmol/10⁶ cells/h

  • Response to Environmental Stressors: During environmental stress, ATP6 function may be modulated to support energy conservation or alternative ATP generation pathways, particularly when transitioning between trophozoite and cyst forms .

How has A. castellanii ATP6 evolved compared to other eukaryotic ATP6 proteins?

Evolutionary analysis of A. castellanii ATP6 reveals interesting patterns when compared to other eukaryotes:

  • Early Divergence: A. castellanii belongs to Amoebozoa, a major taxonomic group that diverged from the animal/fungal lineage after the split from plants. Its ATP6 reflects this early evolutionary branching .

  • Hybrid Features: A. castellanii mitochondrial physiology shows features common to both animal and plant lineages, including a plant-type mitochondrial respiratory chain with additional dehydrogenases and an alternative oxidase .

  • Unique Adaptations: The ATP6 sequence contains adaptations that may reflect A. castellanii's free-living lifestyle and ability to survive in diverse environments, which differentiates it from obligate parasitic protists.

  • Conservation of Critical Residues: Despite evolutionary divergence, functionally important regions of ATP6, particularly those involved in proton translocation and interaction with other subunits, show conservation across eukaryotic lineages.

  • Phylogenetic Relationship: Phylogenetic analysis of other A. castellanii mitochondrial proteins (such as UCP) shows they diverge very early from other orthologs but clearly locate within their respective subfamilies rather than among other mitochondrial carrier proteins . Similar patterns likely exist for ATP6.

What can structural comparisons between A. castellanii ATP6 and other organisms' ATP6 reveal about function?

Structural comparison of A. castellanii ATP6 with other organisms' ATP6 proteins yields significant insights into functional conservation and specialization:

  • Transmembrane Domain Architecture: A. castellanii ATP6 consists of multiple transmembrane helices embedded within the inner mitochondrial membrane, similar to ATP6 from other organisms. Variations in the number and arrangement of these helices may affect proton translocation efficiency.

  • Critical Functional Residues:

    • In icefish C. gunnari, a hydrophobic alanine at position 35 replaces a hydrophilic serine seen in other notothenioids

    • This amino acid change is significant as it may have a structural impact on the protein

    • Similar substitutions in A. castellanii ATP6 could point to functional adaptations

  • Alternative Start Codons: In notothenioid species, ATP6 has an alternative start codon (GTG) which could be related to higher thermal stability with altered expression of this protein . The start codon usage in A. castellanii ATP6 may similarly reflect adaptations to its environmental niche.

  • Interaction Domains: Regions involved in interactions with other ATP synthase subunits, particularly the c-ring, show varying degrees of conservation. These differences may influence the efficiency of rotation and coupled ATP synthesis.

  • Proton Channel Formation: Specific residues forming the proton half-channels in ATP6 are likely conserved across species, but subtle variations may exist that affect proton translocation kinetics and energy coupling efficiency.

How does ATP6 contribute to A. castellanii pathogenicity?

A. castellanii is an opportunistic pathogen causing keratitis, granulomatous amoebic encephalitis, and cutaneous acanthamoebiasis. ATP6 contributes to its pathogenicity through several mechanisms:

  • Energy Production for Virulence: The ATP synthase complex containing ATP6 generates ATP necessary for the parasite's motility, attachment, and host cell invasion. Experiments reveal that inhibition of oxidative phosphorylation with cyanide (which blocks electron transport upstream of ATP synthesis) results in decreased gliding movements and complete growth arrest of A. castellanii trophozoites .

  • Adaptation to Host Environments: During infection, A. castellanii must adapt to various microenvironments within the host. The ATP synthase complex enables metabolic flexibility, allowing the parasite to utilize different energy sources available in host tissues.

  • Resistance to Oxidative Stress: A. castellanii can prevent increased reactive oxygen species (ROS) generation by maintaining constant ROS levels. While this involves the uncoupling protein (AcUCP), the ATP synthase complex including ATP6 plays a complementary role in managing cellular energetics during oxidative stress .

  • Encystation Support: During adverse conditions in the host, A. castellanii can form resistant cysts. ATP6 and energy metabolism are implicated in this process, with studies showing phosphate uptake is important for both trophozoite and cyst energetic metabolism . Sodium P-type ATPase (distinct from ATP synthase) has been linked to encystation, suggesting complex interplay between different ATPases during life cycle transitions .

  • Bioenergetic Responses to Infection: When A. castellanii itself is infected (e.g., by Campylobacter jejuni), its energy metabolism shows significant alterations including increased aerobic glycolysis and gluconeogenesis , highlighting the central role of bioenergetic pathways in host-pathogen interactions.

Can recombinant A. castellanii ATP6 serve as a therapeutic target for Acanthamoeba infections?

Recombinant A. castellanii ATP6 shows promise as a therapeutic target due to several factors:

  • Essential Function: ATP6 is essential for proper ATP synthase function and energy production in A. castellanii. Targeting this protein could impair the parasite's bioenergetics and survival.

  • Structural Differences from Human ATP6: Despite functional conservation, A. castellanii ATP6 shows sufficient structural differences from human ATP6 to allow for selective targeting. These differences include:

    • Unique amino acid sequences in the proton channel region

    • Different electrostatic surface properties

    • Potential variations in inhibitor binding sites

  • Potential Drug Development Approaches:

    • Structure-based design of inhibitors specifically targeting A. castellanii ATP6

    • Screening for compounds that disrupt ATP6 interactions with other subunits

    • Development of immunotherapeutic approaches using recombinant ATP6 as an antigen

  • Synergistic Therapy Potential: Studies with other metabolic enzymes suggest combined targeting approaches may be effective. For example, cysteine synthase (AcCS) has been identified as a potential drug target because humans lack this enzyme . Similarly, ATP6 could be part of a multi-target therapeutic strategy.

  • Experimental Evidence for ATPase Targeting: Ouabain, an ATPase inhibitor that targets the Na⁺/K⁺ ion pump (a different ATPase), has been shown to decrease the encystation rate of Acanthamoeba. While this targets a different ATPase, it demonstrates the therapeutic potential of targeting energy-related ion pumps . Research suggests combining ouabain with polyhexamethylene biocide (PHMB) may enhance treatment efficacy against Acanthamoeba keratitis .

How can site-directed mutagenesis of A. castellanii ATP6 provide insights into its functional mechanism?

Site-directed mutagenesis offers powerful insights into ATP6 function through systematic analysis of key residues:

  • Critical Residue Identification Targets:

    • Conserved arginine residues in the proton channel that are essential for proton translocation

    • Interface residues that interact with the c-ring to form the functional proton path

    • Residues potentially involved in Na⁺ specificity (if A. castellanii ATP synthase has Na⁺ dependence)

    • Amino acids at the interface with other subunits that may affect complex stability

  • Experimental Design Strategy:

    • Express recombinant wild-type and mutant ATP6 proteins in E. coli

    • Reconstitute proteins into proteoliposomes with other ATP synthase subunits

    • Measure ATP synthesis rates, proton/sodium translocation, and complex stability

    • Perform comparative analyses between mutants to map functional domains

  • Analyses of Mutations in Related Systems:
    Studies of ATP synthases in other organisms have revealed important insights through mutagenesis:

    • In the E. callanderi ATP synthase, Na⁺-specific activity requires key residues in the c subunit that interact with ATP6

    • Mutations in human ATP6 cause severe diseases by disrupting proton flow and ATP synthesis

  • Coupling Mutagenesis with Biophysical Studies:

    • Combine mutagenesis with electron microscopy to visualize structural changes

    • Use molecular dynamics simulations to predict effects of mutations on proton/ion paths

    • Apply spectroscopic methods (FTIR, NMR) to mutants to analyze changes in protein dynamics

  • Potential Applications of Findings:

    • Design of specific inhibitors targeting the identified critical residues

    • Engineering of ATP6 with modified properties for biotechnological applications

    • Understanding evolutionary adaptation of ATP synthase across different environmental niches

What challenges exist in studying the interaction between A. castellanii ATP6 and other ATP synthase subunits?

Investigating interactions between ATP6 and other ATP synthase subunits presents several significant challenges:

  • Complex Membrane Protein Expression and Purification:

    • Hydrophobic nature of ATP6 makes it difficult to express in soluble form

    • Maintaining native conformation during purification requires careful detergent selection

    • Assembly with other subunits may require specific lipid environments

  • Reconstitution of Functional Complexes:

    • Complete ATP synthase complex contains multiple subunits with specific stoichiometry

    • Some subunits are encoded by nuclear genome while ATP6 is mitochondrially encoded

    • Assembly factors present in mitochondria may be absent in recombinant systems

  • Technical Limitations in Structural Studies:

    • High-resolution structural analysis of membrane protein complexes remains challenging

    • Cryo-EM studies require stable, homogeneous preparations

    • Different detergents or lipid environments may affect subunit interactions

  • Functional Assay Complexity:

    • Measuring ATP synthesis requires generation of proton gradients across membranes

    • Distinguishing ATP6-specific effects from other subunit contributions is difficult

    • Threshold values for ATP synthesis in different ATP synthases vary (from 87-150 mV)

  • Evolutionary Heterogeneity:

    • A. castellanii contains a plant-type mitochondrial respiratory chain with unique features

    • The organism may possess both classical and alternative components of the ATP synthase

    • Studies with other ATP synthases show interesting variations:

      ATP Synthase SourceMinimum Threshold for ATP SynthesisDriving Force Requirements
      E. callanderi87 mVCan use Δψ alone
      A. woodii90 mVCan use Δψ alone, but not ΔpNa
      P. modestum120 mVRequires both Δψ and ΔpNa
      E. coli150 mVRequires both Δψ and ΔpH

      Data from reconstituted ATP synthases in liposomes

What does A. castellanii ATP6 reveal about the evolution of mitochondrial function?

A. castellanii ATP6 provides valuable insights into mitochondrial evolution and adaptation:

  • Ancient ATP Synthase Structure: A. castellanii represents an early-diverging eukaryotic lineage, making its ATP6 valuable for understanding the ancestral features of mitochondrial ATP synthases .

  • Transitional Organelle Evidence: A. castellanii possesses a complete set of enzymes comprising a hydrogenosome-like ATP generation pathway predicted to be targeted to mitochondria, alongside a conventional electron transport chain . This represents a modern analog of a transitional organelle between mitochondria and hydrogenosomes.

  • Adaptive Evolution Patterns: The retention of both aerobic and potentially anaerobic ATP generation pathways in A. castellanii suggests an evolutionary history involving adaptation to varying oxygen levels .

  • Genomic Organization Insights: The mitochondrial genome organization in A. castellanii, including the arrangement of ATP6 and adjacent genes, provides clues about the evolution of mitochondrial gene expression and processing.

  • Functional Constraints on ATP6 Evolution: Despite substantial sequence divergence, functional constraints on proton translocation have maintained critical aspects of ATP6 structure across evolutionary history, illuminating the fundamental requirements for ATP synthase function.

How does understanding A. castellanii ATP6 contribute to knowledge about mitochondrial disorders?

Studying A. castellanii ATP6 offers valuable contributions to our understanding of mitochondrial disorders:

  • Model for Pathogenic Mutations: Recombinant A. castellanii ATP6 can serve as a model system to study the effects of mutations analogous to those causing human mitochondrial disorders. Research on other ATP6 mutations has shown impacts such as:

    • A 2 bp microdeletion at positions 9205-9206 (9205ΔTA) in human ATP6 prevents synthesis of ATP6 subunit and causes formation of incomplete ATPase complexes capable of ATP hydrolysis but not synthesis

    • Such mutations also affect biogenesis of cytochrome c oxidase (COX), which is present in decreased amounts in cells from affected individuals

  • Alternative Energy Pathways: A. castellanii's dual ATP production systems provide insights into how cells might compensate for ATP synthase deficiencies through alternative energy production pathways .

  • Protein-Protein Interactions: Studies of how A. castellanii ATP6 interacts with other subunits can illuminate the molecular basis of disorders caused by improper assembly of the ATP synthase complex.

  • Mitochondrial RNA Processing: Analysis of ATP6 transcript processing in A. castellanii can provide comparative insights into disorders caused by defects in mitochondrial RNA processing. For example, the 9205ΔTA mutation affects the cleavage site between ATP6 and COX3 transcripts, reducing processing efficiency 2-3 fold .

  • Therapeutic Strategy Development: Understanding the fundamental mechanisms of ATP6 function across evolutionary diverse systems may suggest novel therapeutic approaches for mitochondrial disorders, such as:

    • Bypassing electron transport chain defects

    • Activating alternative ATP production pathways

    • Stabilizing partially assembled ATP synthase complexes

What emerging technologies could advance our understanding of A. castellanii ATP6 function?

Several cutting-edge technologies hold promise for deepening our understanding of A. castellanii ATP6:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural determination of the complete A. castellanii ATP synthase complex

    • Visualization of conformational changes during the catalytic cycle

    • Identification of unique structural features compared to other eukaryotic ATP synthases

  • Single-Molecule Techniques:

    • FRET-based approaches to monitor subunit movements during ATP synthesis

    • Optical or magnetic tweezers to measure force generation and rotational dynamics

    • Patch-clamp of reconstituted ATP6 to directly measure proton currents

  • Advanced Genetic Tools:

    • CRISPR-Cas9 genome editing of A. castellanii to create ATP6 variants

    • Inducible expression systems to control ATP6 levels in vivo

    • Site-specific incorporation of unnatural amino acids for precise functional studies

  • Artificial Intelligence and Computational Biology:

    • Machine learning for prediction of ATP6 interaction networks

    • Molecular dynamics simulations of proton translocation through ATP6

    • Quantum mechanical calculations of proton transfer energetics

  • Synthetic Biology Approaches:

    • Creation of minimal ATP synthase systems incorporating A. castellanii ATP6

    • Engineering hybrid ATP synthases with components from different organisms

    • Development of biosensors based on ATP6 conformational changes

What are the most promising research questions regarding A. castellanii ATP6 that remain unanswered?

Several critical questions about A. castellanii ATP6 remain to be addressed:

  • Structural-Functional Relationships:

    • What are the atomic-level details of A. castellanii ATP6 structure, particularly in the proton channel region?

    • How do conformational changes in ATP6 couple to c-ring rotation and ATP synthesis?

    • Are there unique structural adaptations that contribute to A. castellanii's metabolic flexibility?

  • Metabolic Switching Mechanisms:

    • How does ATP6 function change when A. castellanii transitions between aerobic and anaerobic metabolism?

    • What regulatory mechanisms control ATP synthase activity during environmental stress?

    • How is ATP6 function integrated with the alternative oxidase and other respiratory chain components?

  • Pathogenesis and Drug Development:

    • Can specific inhibitors targeting A. castellanii ATP6 be developed as anti-acanthamoeba therapeutics?

    • How does ATP6 function contribute to survival during host infection?

    • Does ATP6 play a role in resistance to current treatments?

  • Evolutionary Significance:

    • Does A. castellanii ATP6 represent an evolutionary intermediate between bacterial and other eukaryotic ATP synthases?

    • What selective pressures have shaped the evolution of A. castellanii ATP6?

    • How has horizontal gene transfer influenced ATP synthase evolution in A. castellanii?

  • Interaction with Host Systems:

    • Does A. castellanii ATP6 interact with host cell components during infection?

    • Can A. castellanii ATP6 serve as an antigen recognized by the host immune system?

    • How does host metabolism affect A. castellanii ATP synthase function during infection?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.