Recombinant Acanthamoeba castellanii NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Structure and Function

ND3 (UniProt ID: Q37382) is a 118-amino acid protein (1–118 aa) with a molecular weight of ~13 kDa. It is fused to an N-terminal His tag for purification and contains a hydrophobic transmembrane domain, consistent with its role as a core subunit in complex I .

Key Features

PropertyDetail
AA SequenceMTLEYIYIFIFFWGAFFISCLLIFLSYFLVYQESDIEKNSAYECGFQPFEDTRSKFNVRY YLIAILFMIFDLEIMYLFPWSISISTGSFFGVWAIFLFLIILTVGFIYEWQKGALEWD
Gene NameND3 (synonyms: NAD3, NADH dehydrogenase subunit 3)
Biological RoleParticipates in electron transfer and proton translocation in complex I .

Complex I, of which ND3 is a subunit, is a ~940 kDa multi-protein assembly responsible for transferring electrons from NADH to ubiquinone while pumping protons across the inner mitochondrial membrane . In Acanthamoeba, ND3 is part of a larger complex that includes γ-type carbonic anhydrases (γCA), suggesting a conserved evolutionary role in mitochondrial function .

Production and Biochemical Properties

ND3 is expressed in E. coli and purified via nickel affinity chromatography due to its His tag. Post-production, it is lyophilized and stored at -20°C/-80°C to maintain stability .

Key Findings

  • Riboflavin + UVA reduces Acanthamoeba viability to 8–22% over 7 days .

  • Cystathionine β synthase and serine-threonine kinase genes are upregulated under oxidative stress, potentially linking to ND3-mediated redox balance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Acanthamoeba castellanii (Amoeba)
Target Names
ND3
Target Protein Sequence
MTLEYIYIFIFFWGAFFISCLLIFLSYFLVYQESDIEKNSAYECGFQPFEDTRSKFNVRY YLIAILFMIFDLEIMYLFPWSISISTGSFFGVWAIFLFLIILTVGFIYEWQKGALEWD
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.