Recombinant Acanthamoeba castellanii NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

2.1 Electron Transfer and Proton Translocation
ND4L is critical for the assembly and catalytic function of complex I, a key enzyme in the mitochondrial respiratory chain. In Acanthamoeba castellanii, complex I operates alongside a cyanide-insensitive alternative oxidase (AOX), enabling flexible electron transport under oxidative stress . Key functions include:

  • Electron Transfer: Facilitates the transfer of electrons from NADH to ubiquinone via FeS clusters and FMN in the peripheral arm .

  • Proton Pumping: Contributes to proton translocation across the inner mitochondrial membrane, generating a proton gradient for ATP synthesis .

2.2 Impact of ND4L Deficiency
Studies using RNA interference in Chlamydomonas reinhardtii demonstrated that ND4L depletion prevents the assembly of the 950-kDa complex I holoenzyme and abolishes enzyme activity . This highlights its essential role in maintaining complex I integrity.

  • Biochemical Studies: Used to investigate complex I assembly, electron transfer mechanisms, and interactions with other subunits .

  • Drug Targeting: Acanthamoeba’s reliance on complex I for ATP production makes ND4L a potential target for antiparasitic agents. Inhibitors of lipid oxidation (e.g., thioridazine, perhexiline) show promise in disrupting Acanthamoeba growth by targeting energy metabolism .

Challenges and Future Directions

Technical Limitations

  • Low Solubility: ND4L’s hydrophobicity complicates recombinant expression and crystallization .

  • Functional Reconstitution: Isolated ND4L lacks intrinsic catalytic activity without other subunits, limiting standalone biochemical assays .

Emerging Applications

  • Parasite Control: Targeting ND4L or associated pathways could reduce Acanthamoeba infections by impairing energy production .

  • Complex I Assembly Models: Studies on ND4L interactions with ND3 and ND1 may elucidate the molecular basis of mitochondrial diseases linked to complex I dysfunction .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ND4L; NAD4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Acanthamoeba castellanii (Amoeba)
Target Names
ND4L
Target Protein Sequence
MTSFNIFFLLFFSFVIFFLGILGIFITRKNIIIILVSIELMLLAVNFNFAIFSVLLEDMF GQVFILYTLTLAGAEAAIGLAILIIFYRIRGIISVNFVTSLKG
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for enzymatic activity. Complex I functions in the transfer of electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 4L (ND4L) in Acanthamoeba castellanii?

NADH-ubiquinone oxidoreductase chain 4L (ND4L) is a small but essential subunit of mitochondrial respiratory chain complex I in Acanthamoeba castellanii. Similar to its human counterpart, A. castellanii ND4L is encoded by the mitochondrial genome and functions as a multi-pass membrane protein embedded in the inner mitochondrial membrane . The protein plays a crucial role in the initial electron transfer steps of oxidative phosphorylation, contributing to the organism's energy production capabilities. In most organisms, ND4L has a molecular mass of approximately 10-11 kDa, making it one of the smaller subunits of complex I .

What is the molecular function of ND4L in the respiratory chain?

ND4L functions as an integral component of the membrane domain of complex I, which is responsible for proton translocation across the inner mitochondrial membrane. The primary biochemical function of ND4L involves the transfer of electrons from NADH to ubiquinone (coenzyme Q) . This electron transfer is coupled with proton pumping across the membrane, contributing to the electrochemical gradient that drives ATP synthesis.

The exact mechanism of ND4L's contribution to proton pumping remains an area of active research, but structural studies of complex I suggest that conformational changes in transmembrane subunits like ND4L may play a key role in coupling electron transfer to proton translocation. The immediate electron acceptor for the enzyme is believed to be ubiquinone, as demonstrated in related systems .

How does ND4L contribute to Acanthamoeba castellanii pathogenicity?

While direct evidence linking ND4L to A. castellanii pathogenicity is limited, its role in energy metabolism provides crucial support for the organism's virulence mechanisms. A. castellanii causes severe infections like Acanthamoeba keratitis and granulomatous amoebic encephalitis , which require significant energy resources during host invasion, attachment, and cytotoxic effects.

Efficient mitochondrial function, to which ND4L contributes, enables A. castellanii to adapt to various environmental conditions during infection. By analogy with studies in other organisms, mutations or dysfunction in ND4L could potentially affect energy production efficiency, which might impact pathogenicity. Research in MS patients has shown that mutations in the related ND4 gene can cause protein instability and potentially affect complex I function , suggesting similar mechanisms might influence A. castellanii virulence through altered energy metabolism.

What expression systems are optimal for recombinant production of A. castellanii ND4L?

For recombinant production of A. castellanii ND4L, several expression systems have been developed with varying degrees of success. The most effective systems include:

Bacterial Expression Systems:

  • E. coli BL21(DE3) with pET vector systems incorporating a fusion tag (His6 or GST) to facilitate purification

  • C41(DE3) and C43(DE3) E. coli strains specifically engineered for membrane protein expression

Eukaryotic Expression Systems:

  • Pichia pastoris for expression of properly folded membrane proteins with post-translational modifications

  • Baculovirus-infected insect cells (Sf9 or Hi5), which provide a eukaryotic environment more similar to the native context

For the bacterial expression systems, optimization typically requires:

  • Codon optimization for E. coli

  • Lower induction temperatures (16-20°C)

  • Low IPTG concentrations (0.1-0.5 mM)

  • Addition of membrane-mimetic environments during purification (detergents like DDM or LDAO)

The choice of expression system should be guided by the specific experimental requirements, with bacterial systems offering higher yield but eukaryotic systems potentially providing better folding and modification patterns.

What purification strategies yield the highest purity and activity for recombinant A. castellanii ND4L?

Purification of recombinant A. castellanii ND4L presents significant challenges due to its hydrophobic nature and tendency to aggregate. The most successful purification strategies employ a multi-step approach:

Step 1: Membrane Extraction

  • Solubilization using mild detergents (DDM, LMNG, or digitonin) at concentrations just above CMC

  • Inclusion of lipid mixtures (0.1-0.5 mg/ml) to stabilize the protein during extraction

Step 2: Initial Purification

  • Affinity chromatography using His-tag or GST-tag

  • Inclusion of glycerol (10-15%) and reducing agents in all buffers

Step 3: Secondary Purification

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography for removal of contaminants

Step 4: Activity Preservation

  • Reconstitution into nanodiscs or liposomes for functional studies

  • Storage in the presence of stabilizing additives (glycerol, specific lipids)

For functional studies, the protein must be maintained in a membrane-like environment throughout purification. Detergent screening is often necessary to identify conditions that preserve activity while enabling purification.

How do mutations in ND4L affect mitochondrial function in Acanthamoeba and related organisms?

Mutations in mitochondrial genes encoding complex I subunits, including ND4L, can significantly impact organismal fitness and biochemical function. Research on related systems provides insights into potential effects in A. castellanii:

Effects of ND4L Mutations:

Mutation TypeBiochemical EffectPhysiological Impact
Missense mutationsProtein destabilizationReduced complex I activity
Regulatory region mutationsAltered expression levelsImbalanced complex I assembly
Deletion mutationsLoss of functional proteinSevere respiratory deficiency

Studies in human patients have identified multiple mutations in the related ND4 gene that cause protein instability and affect complex I function . For example, the missense mutations m.11150G>A, m.11519A>C, and m.11523A>C in the ND4 gene were predicted to be deleterious and directly cause protein instability . By analogy, similar mutations in A. castellanii ND4L would likely compromise mitochondrial function.

In adaptation studies of high-altitude organisms, specific SNPs in MT-ND4L have been associated with environmental adaptation . Particularly, haplotype Ha1 in MT-ND4L showed positive associations with high-altitude adaptability in Tibetan yaks , demonstrating the importance of this gene in metabolic adaptation to challenging environments.

What is the relationship between ND4L function and adaptation to environmental stress?

ND4L plays a crucial role in adaptation to environmental stress, particularly in conditions requiring metabolic adaptation. Analysis of genetic diversity in MT-ND4L genes across different species has revealed:

  • Specific haplotypes of MT-ND4L (e.g., Ha1) show positive associations with high-altitude adaptability, while others (e.g., Ha3) show negative associations

  • SNPs in MT-ND4L contribute to adaptation mechanisms that allow organisms to thrive in hypoxic environments

  • The adaptation mechanisms likely involve optimized electron transfer efficiency and potentially reduced reactive oxygen species (ROS) production

For A. castellanii, which encounters varied environments including the human host, ND4L function may be critical for:

  • Adaptation to oxygen-limited environments during infection

  • Temperature fluctuations between environmental and host conditions

  • Stress responses during exposure to host immune defenses

The genetic diversity observed in MT-ND4L across species underscores its importance in adaptation to challenging environments, suggesting similar mechanisms might operate in A. castellanii.

How can activity of recombinant A. castellanii ND4L be measured in vitro?

Measuring the activity of recombinant A. castellanii ND4L requires assessing its contribution to complex I function. Several complementary approaches can be employed:

1. NADH:Ubiquinone Oxidoreductase Activity Assays:

  • Spectrophotometric measurement of NADH oxidation (decrease in absorbance at 340 nm)

  • Measurement of ubiquinone reduction using artificial electron acceptors

  • Oxygen consumption analysis using polarographic methods

2. Electron Transfer Assays:

  • Measurement of electron transfer rates using stopped-flow spectroscopy

  • Analysis of flavin and iron-sulfur cluster reduction kinetics

3. Proton Translocation Measurements:

  • pH-sensitive fluorescent probes to monitor proton movement

  • Membrane potential measurements using voltage-sensitive dyes

Protocol Example: NADH:Ubiquinone Oxidoreductase Activity Assay

  • Reconstitute purified recombinant ND4L with other complex I components

  • Prepare reaction buffer (50 mM phosphate buffer pH 7.4, 2 mM EDTA, 2 mM KCN)

  • Add 100 μM NADH and monitor absorbance at 340 nm

  • Initiate reaction with 60 μM ubiquinone

  • Calculate activity as nmol NADH oxidized/min/mg protein

When studying recombinant ND4L in isolation, it may be necessary to reconstitute it with other complex I components or develop specialized assays that focus on specific aspects of its function, such as ubiquinone binding or protein-protein interactions.

What structural biology approaches can be applied to study recombinant A. castellanii ND4L?

Understanding the structure-function relationship of ND4L requires advanced structural biology techniques:

1. Cryo-Electron Microscopy (Cryo-EM):

  • Most successful approach for membrane protein complexes

  • Can resolve structures to near-atomic resolution

  • Enables visualization of ND4L in the context of the entire complex I

2. X-ray Crystallography:

  • Challenging for membrane proteins but possible with specialized approaches

  • Lipidic cubic phase crystallization for membrane proteins

  • May require fusion partners to enhance crystallization

3. Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Solution NMR for smaller fragments or domains

  • Solid-state NMR for studying the protein in a membrane environment

  • Can provide dynamics information not available from static structures

4. Mass Spectrometry-Based Approaches:

  • Hydrogen/deuterium exchange mass spectrometry for conformational dynamics

  • Cross-linking mass spectrometry for protein-protein interaction mapping

  • Native mass spectrometry for complex assembly analysis

5. Computational Structural Biology:

  • Homology modeling based on related structures

  • Molecular dynamics simulations to study conformational changes

  • Quantum mechanics/molecular mechanics approaches for electron transfer mechanisms

Integration of multiple structural approaches with functional studies provides the most comprehensive understanding of ND4L structure-function relationships. Recent advances in cryo-EM have revolutionized the study of membrane protein complexes, making it particularly suitable for studying ND4L in its native context within complex I.

How can recombinant A. castellanii ND4L be used for drug discovery against Acanthamoeba infections?

Recombinant A. castellanii ND4L offers several advantages for drug discovery efforts targeting Acanthamoeba infections:

1. Target-Based Screening Approaches:

  • High-throughput screening of compound libraries against purified recombinant ND4L

  • Fragment-based drug discovery to identify initial binding molecules

  • Structure-based design utilizing computational docking and virtual screening

2. Assay Development for Drug Screening:

  • Biophysical assays (thermal shift, surface plasmon resonance) to detect binding

  • Functional assays to identify inhibitors of ND4L activity

  • Cellular assays to confirm target engagement in intact organisms

3. Rational Design Strategy:

  • Identification of crucial residues through mutagenesis

  • Design of peptide-based inhibitors targeting protein-protein interactions

  • Development of allosteric modulators affecting conformational changes

Research on Acanthamoeba has identified that targeting metabolic pathways can be effective for treatment. For example, azole compounds have been validated as effective against Acanthamoeba by targeting sterol biosynthesis . By analogy, compounds targeting the mitochondrial respiratory chain, specifically complex I where ND4L functions, could provide similar therapeutic opportunities. The advantage of targeting ND4L is its essential role in energy production, making resistance development less likely.

What are the potential differences between A. castellanii ND4L and human homologs that could be exploited for selective inhibition?

Developing selective inhibitors requires understanding the structural and functional differences between A. castellanii ND4L and its human counterpart:

Key Differences with Therapeutic Potential:

FeatureA. castellanii ND4LHuman MT-ND4LTherapeutic Implication
Amino acid sequenceSpecies-specific variationsHuman-specific residuesTarget unique residues for selectivity
Binding pocket structureMay contain unique featuresWell-characterizedDesign inhibitors for parasite-specific pockets
Protein-protein interactionsPotentially different interfacesKnown interfacesTarget parasite-specific interfaces
Post-translational modificationsMay differ from human patternsWell-studiedTarget unique modification patterns

Structural analysis of complex I from various species has revealed that while the core electron transfer mechanism is conserved, there are significant differences in specific residues and interactions. These differences can be exploited for drug development, similar to how the unique sterol biosynthesis pathway in Acanthamoeba has been successfully targeted with azole compounds like tioconazole and voriconazole .

The most promising approach would involve identifying unique binding pockets or interaction surfaces in A. castellanii ND4L that are absent or significantly different in the human homolog, then designing compounds that selectively interact with these features.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.