Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ domain-containing protein R224 (MIMI_R224)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ Domain-Containing Protein R224 (MIMI_R224)

Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ domain-containing protein R224 (MIMI_R224) is a protein derived from the Acanthamoeba polyphaga mimivirus (APMV) and produced using recombinant DNA technology . MIMI_R224 contains a BTB/POZ domain, which is often involved in protein-protein interactions and transcriptional regulation . Recombinant proteins like MIMI_R224 are produced in a host organism, such as E. coli, and are used for research purposes .

Protein Structure and Function

MIMI_R224 is a full-length protein consisting of 540 amino acids . The amino acid sequence is:

MDHLNLCRYLTESILTDLELTLIDENENTLVINVHKLILSINCQYFETLFSGQFIDSQKN
NLKLLVPDIHVVRDIIYGFYKNPIKYKNYPDWLYELKKIVCQNFLCLETNIEILHNIIVP
TNGFDKLLDTIDLIGYDSDTISLLVGNMPDNYDLTKLPIELIRQMFDVPMFNMIYVSDKD
GTFKIGNGNISFNITSNTLINNGHFEFSSIHNKIIYHHVCDIYVYDLLNYTTNKFTNPIS
HTIKSIVLTPDQEYIIYDSSPQIISKFDFISMEIIESRFAPTGAVVNDIFSSTELGHFGK
IEELQCCNPNLLIIGSNVLSFYNVNDMLLMNIIENNIIPNDLYGRIYSSSIKKGRIFVSL
LNDIIFVLSSINMYFIKPDTYEYIKKIHCNNFYNHDYCATNNDFWDICNINQDVIAILVG
NLLTIYNWKLDKTIIQIDICHTECNGSYCKIDKIVYDSTTKLLFVDCSNSRSGKKIYSIL
MDNIDLNIPINNVDFSIFSKNKIMRYGNPKCISGIKKFKIIDNYKSKLYNNIEKYLKNNQ .

Proteins have different levels of structure:

  • Primary Structure: This is the linear sequence of amino acids in the polypeptide chain .

  • Secondary Structure: Local folding of the polypeptide chain into alpha-helices and beta-pleated sheets, stabilized by hydrogen bonds . Alpha-helices are cylindrical structures formed by a twisting chain of amino acids, while beta-pleated sheets are formed by adjacent strands connected by hydrogen bonds .

  • Tertiary Structure: The three-dimensional structure of the protein, influenced by interactions between R groups, including hydrophobic interactions, ionic bonds, and hydrogen bonds .

  • Quaternary Structure: The arrangement of multiple polypeptide chains in a multi-subunit protein .

The presence of a BTB/POZ domain suggests MIMI_R224 is involved in protein-protein interactions and possibly transcriptional regulation . BTB/POZ domains are known to mediate homo- and hetero-oligomerization, which is crucial for various cellular processes.

Production and Characteristics of Recombinant MIMI_R224

Recombinant MIMI_R224 is produced in E. coli with an N-terminal His tag for purification purposes . Key characteristics of the recombinant protein include:

CharacteristicDescription
SourceE. coli
TagHis tag (N-terminal)
Protein LengthFull Length (1-540 amino acids)
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, with aliquoting recommended for multiple uses; avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C
Gene NameMIMI_R224
SynonymsMIMI_R224; Putative BTB/POZ domain-containing protein R224
UniProt IDQ5UQB7

Applications in Research

Recombinant MIMI_R224 can be utilized in various research applications:

  • ELISA assays: Recombinant MIMI_R224 can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify antibodies against the mimivirus in biological samples .

  • Protein interaction studies: The BTB/POZ domain makes it suitable for studying protein-protein interactions .

  • Structural studies: Determining the three-dimensional structure of MIMI_R224 can provide insights into its function and interactions .

  • Functional assays: Investigating the role of MIMI_R224 in viral replication and host cell interactions.

Guidelines for Results Presentation

When presenting research findings related to MIMI_R224, it is essential to follow established guidelines for clarity and accuracy .

  • Tables: Tables should be comprehensible without reference to the main text, with clear titles and descriptive column heads . Units of each variable should be defined, and the sample size of each group should be indicated .

  • Figures: Figures should be clear and informative, with concise legends .

  • Results Section: The sequence of results should be logical, and any references should be avoided in this section . Insignificant changes should not be described using terms like "increased" or "decreased" .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MIMI_R224; Putative BTB/POZ domain-containing protein R224
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-540
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R224
Target Protein Sequence
MDHLNLCRYLTESILTDLELTLIDENENTLVINVHKLILSINCQYFETLFSGQFIDSQKN NLKLLVPDIHVVRDIIYGFYKNPIKYKNYPDWLYELKKIVCQNFLCLETNIEILHNIIVP TNGFDKLLDTIDLIGYDSDTISLLVGNMPDNYDLTKLPIELIRQMFDVPMFNMIYVSDKD GTFKIGNGNISFNITSNTLINNGHFEFSSIHNKIIYHHVCDIYVYDLLNYTTNKFTNPIS HTIKSIVLTPDQEYIIYDSSPQIISKFDFISMEIIESRFAPTGAVVNDIFSSTELGHFGK IEELQCCNPNLLIIGSNVLSFYNVNDMLLMNIIENNIIPNDLYGRIYSSSIKKGRIFVSL LNDIIFVLSSINMYFIKPDTYEYIKKIHCNNFYNHDYCATNNDFWDICNINQDVIAILVG NLLTIYNWKLDKTIIQIDICHTECNGSYCKIDKIVYDSTTKLLFVDCSNSRSGKKIYSIL MDNIDLNIPINNVDFSIFSKNKIMRYGNPKCISGIKKFKIIDNYKSKLYNNIEKYLKNNQ
Uniprot No.

Target Background

Database Links

KEGG: vg:9924831

Protein Families
Mimivirus BTB/WD family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of MIMI_R224 in Acanthamoeba polyphaga mimivirus?

MIMI_R224 is a putative BTB/POZ domain-containing protein encoded by the Acanthamoeba polyphaga mimivirus genome. BTB/POZ domains are protein-protein interaction motifs that primarily function in transcriptional regulation through homo- and heterodimerization . Within the mimivirus context, MIMI_R224 likely participates in protein complex formation critical for viral replication and transcriptional control. Similar to other BTB domain proteins identified in viruses, it may modulate host-pathogen interactions by interacting with host transcriptional machinery or other viral proteins during infection cycles.

How does MIMI_R224 compare structurally to other BTB/POZ domain-containing proteins?

Structural analysis reveals that MIMI_R224, like other BTB/POZ domain proteins, likely forms obligate dimers stabilized primarily through electrostatic interactions and hydrophobic forces . While some BTB domain proteins such as BACH2 contain disulfide bonds that stabilize their homodimeric structure, molecular dynamics simulations indicate that MIMI_R224 relies predominantly on non-covalent interactions for dimer stability . The dimerization interface typically involves the α1 helix, β1 strand, α2 helix, and β2 strand of the BTB domain, creating a characteristic fold that facilitates protein-protein interactions critical for function.

What is the expression pattern of MIMI_R224 during the mimivirus replication cycle?

Based on studies of mimivirus replication, MIMI_R224 likely follows the temporal expression pattern observed for other viral proteins involved in transcriptional regulation. Similar to other mimivirus proteins found within virions, MIMI_R224 may be expressed early during infection and packaged into new virions . The presence of transcriptional regulators within mimivirus particles suggests their importance in the early stages of infection, potentially priming host machinery for viral replication before viral gene expression begins . Quantitative PCR and transcriptomic analyses throughout the infection cycle would be required to precisely map MIMI_R224 expression patterns.

What are the optimal methods for recombinant expression and purification of MIMI_R224?

For recombinant expression of MIMI_R224, a bacterial expression system using E. coli BL21(DE3) with a pET-based vector containing an N-terminal His-tag is recommended. Expression should be induced with 0.5-1.0 mM IPTG at 18°C overnight to minimize inclusion body formation. For purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin followed by size exclusion chromatography effectively isolates the protein.

The following purification protocol yields high-purity protein:

Purification StepBuffer CompositionConditionsExpected Yield
Cell Lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTTSonication or French press-
IMACSame as lysis + 20-250 mM imidazole gradient4°C, flow rate 1 ml/min15-20 mg/L culture
Size Exclusion20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTTSuperdex 200 column10-15 mg/L culture

Protein stability is enhanced with the addition of 10% glycerol to storage buffers, and aliquots should be flash-frozen in liquid nitrogen for long-term storage at -80°C.

How can I assess the dimerization properties of MIMI_R224 in vitro and in cellular contexts?

Multiple complementary approaches should be employed to thoroughly characterize MIMI_R224 dimerization:

For in vitro assessment:

  • Analytical size exclusion chromatography comparing elution volumes with known standards

  • Dynamic light scattering to determine hydrodynamic radius

  • Analytical ultracentrifugation for precise molecular weight determination

  • Isothermal titration calorimetry to quantify binding thermodynamics

For cellular contexts, the fluorescent two-hybrid assay (F2H) has proven effective for BTB domain proteins . This approach involves:

  • Tagging MIMI_R224 with fluorescent proteins (e.g., tagGFP and tagRFP)

  • Expressing these constructs in mammalian cells

  • Visualizing interaction through fluorescence microscopy, where co-localization of fluorescent signals indicates dimerization

Cross-linking studies using reagents like BS3 or formaldehyde followed by SDS-PAGE and western blot analysis can further confirm dimerization in cellular extracts.

What methodologies are recommended for investigating MIMI_R224 interactions with host proteins?

A multi-faceted approach is necessary to comprehensively map MIMI_R224 host protein interactions:

  • Affinity Purification-Mass Spectrometry (AP-MS): Express tagged MIMI_R224 in amoeba cells, perform pull-downs, and identify binding partners by LC-MS/MS. This approach identified mimivirus proteins L442, L724, L829, R387 and R135 in previous studies .

  • Proximity-Based Labeling: BioID or APEX2 fusion proteins can identify transient or weak interactions through proximity-dependent biotinylation.

  • Yeast Two-Hybrid Screening: Using amoeba cDNA libraries to identify potential interactors, followed by validation.

  • Co-immunoprecipitation: With antibodies against MIMI_R224 or potential host targets.

For validation and characterization of identified interactions:

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • ELISA-based binding assays for interaction specificity

  • Cellular co-localization studies using fluorescently-tagged proteins

  • Functional assays to assess the biological significance of interactions

How can I determine the crystal structure of MIMI_R224's BTB/POZ domain?

Obtaining the crystal structure of MIMI_R224's BTB/POZ domain requires a systematic approach:

  • Construct Optimization: Create several constructs with varying domain boundaries based on secondary structure predictions and disorder analysis.

  • Protein Production: Express and purify protein as described in section 2.1, ensuring monodispersity by dynamic light scattering.

  • Crystallization Screening: Employ commercial sparse matrix screens (Hampton Research, Molecular Dimensions) at protein concentrations of 5-15 mg/ml using sitting-drop vapor diffusion at both 4°C and 18°C.

  • Optimization: Refine promising conditions by varying precipitant concentration, pH, and additives.

  • Data Collection: Collect X-ray diffraction data at synchrotron radiation facilities.

  • Structure Determination: Use molecular replacement with known BTB domain structures as search models , followed by iterative model building and refinement.

If crystallization proves challenging, consider alternative approaches such as NMR spectroscopy for smaller constructs or cryo-electron microscopy for larger assemblies.

What computational approaches can predict MIMI_R224 interaction partners and potential functions?

Multiple computational strategies can provide insights into MIMI_R224 functions:

  • Homology Modeling: Using Phyre2 as employed for other mimivirus proteins to predict three-dimensional structure based on known BTB/POZ domains.

  • Molecular Dynamics Simulations: To analyze the stability of predicted homo- and heterodimers, identifying key residues involved in dimerization .

  • Protein-Protein Docking: Tools like HADDOCK or ClusPro to model interactions with potential partners.

  • Sequence-Based Predictions:

    • Conserved domain analysis

    • Prediction of post-translational modifications

    • Identification of short linear motifs that may mediate protein interactions

  • Evolutionary Analysis: Examining conservation patterns across mimivirus strains and related giant viruses to identify functionally important regions.

  • Gene Expression Correlation Analysis: Similar to the approach used for ZBTB proteins , analyzing co-expression patterns with other mimivirus genes to predict functional relationships.

How does the dimerization of MIMI_R224 compare with other BTB/POZ domain proteins in terms of specificity?

Based on studies of other BTB/POZ domain proteins, dimerization specificity varies considerably. In the ZBTB family, all tested BTB domains can form homodimers, while heterodimer formation is rare, with only a single pair identified in comprehensive testing . This suggests MIMI_R224 likely has a strong preference for homodimerization.

Dimerization specificity is determined by:

  • Interface Complementarity: The shape and charge distribution at the dimerization interface

  • Key Residues: Specific amino acids at the interface that determine compatibility

  • Stabilizing Forces: The balance of electrostatic, hydrophobic, and hydrogen-bonding interactions

Experimental determination of MIMI_R224's dimerization preferences would require:

  • Construction of a dimerization matrix similar to that reported for ZBTB proteins

  • Quantitative measurement of binding affinities using methods like isothermal titration calorimetry

  • Mutational analysis to identify specificity-determining residues

How can I establish an in vitro transcription system to study MIMI_R224's role in gene regulation?

To investigate MIMI_R224's potential role in transcriptional regulation, establish an in vitro transcription system with the following components:

  • Template Preparation:

    • Design DNA templates containing putative binding sites based on motif analysis

    • Include control templates with mutated binding sites

  • Protein Components:

    • Purified recombinant MIMI_R224

    • RNA polymerase (either viral or host-derived)

    • General transcription factors from host

  • Transcription Assay Setup:

ComponentConcentrationPurpose
Template DNA10-20 nMTranscription substrate
MIMI_R22410-500 nMTest protein
RNA polymerase50-100 nMTranscription enzyme
NTPs0.5 mM eachSubstrates for RNA synthesis
Buffer20 mM HEPES pH 7.9, 100 mM KCl, 10 mM MgCl₂, 0.1 mM EDTA, 1 mM DTTReaction environment
  • Analysis Methods:

    • Quantify transcript levels using radiolabeled nucleotides or fluorescent detection

    • Analyze transcripts by gel electrophoresis or capillary electrophoresis

    • Perform kinetic analyses to determine the effect of MIMI_R224 on transcription rates

  • Controls:

    • Include reactions without MIMI_R224 to establish baseline transcription

    • Use known transcriptional regulators as positive controls

    • Test mutated versions of MIMI_R224 to identify functional domains

What approaches can determine if MIMI_R224 is essential for mimivirus replication?

Determining the essentiality of MIMI_R224 for mimivirus replication requires several complementary approaches:

  • Genetic Manipulation:

    • CRISPR-Cas9 genome editing of the mimivirus genome to disrupt the R224 gene

    • Construction of conditional mutants using inducible systems

    • Complementation studies with wild-type protein to confirm phenotypes

  • Microinjection-Based Approach:

    • Similar to the methodology described for other mimivirus proteins , microinject Acanthamoeba with modified viral DNA lacking or containing mutations in the R224 gene

    • Monitor viral production through microscopy, flow cytometry, and genomic analysis

  • Dominant Negative Approaches:

    • Express mutated versions of MIMI_R224 designed to interfere with wild-type function

    • Assess the impact on viral replication kinetics

  • Small Molecule Inhibitors:

    • Develop or identify compounds that specifically target MIMI_R224 function

    • Test their effect on viral replication in culture

  • Quantitative Assessment:

    • Measure viral DNA replication, transcription, and virion production

    • Use scanning electron microscopy to evaluate virion morphology

    • Apply flow cytometry for quantitative analysis of viral particles

How can I investigate whether MIMI_R224 interacts with DNA directly or functions primarily through protein-protein interactions?

A comprehensive investigation of MIMI_R224's mode of action requires multiple experimental approaches:

  • DNA Binding Assays:

    • Electrophoretic mobility shift assays (EMSA) with labeled DNA fragments

    • DNase I footprinting to identify specific binding sites

    • Chromatin immunoprecipitation (ChIP) to identify genomic binding sites in infected cells

    • Systematic evolution of ligands by exponential enrichment (SELEX) to determine binding motifs

  • Structural Studies:

    • X-ray crystallography or cryo-EM of MIMI_R224 in complex with DNA

    • NMR spectroscopy to map interaction surfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify regions protected upon DNA binding

  • Protein Interaction Mapping:

    • Yeast two-hybrid or mammalian two-hybrid assays

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

  • Functional Analysis:

    • Mutagenesis of predicted DNA-binding residues versus protein-interaction surfaces

    • Domain swapping experiments with other BTB/POZ proteins

    • In vitro transcription assays with purified components

  • Cellular Localization:

    • Fluorescence microscopy of tagged MIMI_R224 during infection

    • Co-localization with DNA or other proteins

    • Live cell imaging to track dynamics during viral replication cycle

What are the current limitations in studying MIMI_R224 and how might they be overcome?

Current research on MIMI_R224 faces several significant challenges:

  • Technical Limitations:

    • Difficulty in culturing and manipulating Acanthamoeba hosts

    • Challenges in microinjection techniques due to amoeba size (<30 μm) and limited adherence

    • Limited availability of genetic tools for mimivirus manipulation

  • Knowledge Gaps:

    • Absence of structural data for many mimivirus proteins

    • Limited understanding of BTB/POZ domain functions in viral contexts

    • Unclear regulatory networks within the mimivirus genome

Innovative Solutions:

  • Development of improved microinjection techniques specifically designed for amoeba, accounting for their unique adhesion properties

  • Adaptation of CRISPR-Cas systems for giant virus genome editing

  • Creation of amoeba cell lines stably expressing fluorescent markers for improved visualization

  • Application of single-cell transcriptomics to track host responses to wild-type versus R224-mutant viruses

  • Development of in vitro systems reconstituting mimivirus transcription machinery

How might MIMI_R224 function differ from BTB/POZ domain proteins in other biological systems?

MIMI_R224 likely exhibits unique features compared to BTB/POZ domains in other systems:

  • Evolutionary Context:

    • Viral BTB/POZ domains may have been acquired from hosts but evolved distinct functions

    • Potential horizontal gene transfer between giant viruses and their hosts creates unique evolutionary pressures

  • Functional Adaptations:

    • While cellular BTB/POZ proteins often function in transcriptional repression, viral versions may have evolved to manipulate host pathways

    • MIMI_R224 may interface with amoeba-specific factors not targeted by other BTB/POZ proteins

    • Potential roles in viral packaging or assembly unique to the mimivirus context

  • Structural Considerations:

    • MIMI_R224 may form different multimeric assemblies beyond the typical dimers seen in cellular BTB/POZ proteins

    • Viral protein interfaces might be optimized for transient rather than stable interactions

  • Host-Pathogen Interactions:

    • MIMI_R224 may function at the interface between viral and host processes

    • Potential involvement in immune evasion mechanisms specific to amoeba hosts

What high-throughput approaches could advance our understanding of MIMI_R224's role in mimivirus biology?

Several cutting-edge high-throughput approaches could significantly accelerate research on MIMI_R224:

  • Proteome-Wide Interaction Mapping:

    • BioID or APEX2 proximity labeling coupled with mass spectrometry

    • Protein microarrays featuring host and viral proteins

    • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • Functional Genomics:

    • CRISPR-Cas9 screening of host factors that interact with MIMI_R224

    • Saturating mutagenesis of MIMI_R224 coupled with viral fitness assays

    • Synthetic genetic array analysis to identify genetic interactions

  • Structural Genomics:

    • Cryo-electron microscopy of MIMI_R224 in different functional states

    • High-throughput crystallization of MIMI_R224 with various binding partners

    • Integrative structural biology combining multiple data types

  • Systems Biology Approaches:

    • Temporal proteomics during infection with wild-type versus R224-mutant viruses

    • Metabolomics to identify changes in host metabolism

    • Network analysis integrating multiple omics datasets

  • Advanced Imaging:

    • Super-resolution microscopy to track MIMI_R224 during infection

    • Correlative light and electron microscopy (CLEM) to visualize MIMI_R224 in the context of viral structures

    • Live-cell imaging with tagged proteins to monitor dynamic interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.