Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ domain-containing protein R224 (MIMI_R224) is a protein derived from the Acanthamoeba polyphaga mimivirus (APMV) and produced using recombinant DNA technology . MIMI_R224 contains a BTB/POZ domain, which is often involved in protein-protein interactions and transcriptional regulation . Recombinant proteins like MIMI_R224 are produced in a host organism, such as E. coli, and are used for research purposes .
MIMI_R224 is a full-length protein consisting of 540 amino acids . The amino acid sequence is:
MDHLNLCRYLTESILTDLELTLIDENENTLVINVHKLILSINCQYFETLFSGQFIDSQKN
NLKLLVPDIHVVRDIIYGFYKNPIKYKNYPDWLYELKKIVCQNFLCLETNIEILHNIIVP
TNGFDKLLDTIDLIGYDSDTISLLVGNMPDNYDLTKLPIELIRQMFDVPMFNMIYVSDKD
GTFKIGNGNISFNITSNTLINNGHFEFSSIHNKIIYHHVCDIYVYDLLNYTTNKFTNPIS
HTIKSIVLTPDQEYIIYDSSPQIISKFDFISMEIIESRFAPTGAVVNDIFSSTELGHFGK
IEELQCCNPNLLIIGSNVLSFYNVNDMLLMNIIENNIIPNDLYGRIYSSSIKKGRIFVSL
LNDIIFVLSSINMYFIKPDTYEYIKKIHCNNFYNHDYCATNNDFWDICNINQDVIAILVG
NLLTIYNWKLDKTIIQIDICHTECNGSYCKIDKIVYDSTTKLLFVDCSNSRSGKKIYSIL
MDNIDLNIPINNVDFSIFSKNKIMRYGNPKCISGIKKFKIIDNYKSKLYNNIEKYLKNNQ .
Proteins have different levels of structure:
Primary Structure: This is the linear sequence of amino acids in the polypeptide chain .
Secondary Structure: Local folding of the polypeptide chain into alpha-helices and beta-pleated sheets, stabilized by hydrogen bonds . Alpha-helices are cylindrical structures formed by a twisting chain of amino acids, while beta-pleated sheets are formed by adjacent strands connected by hydrogen bonds .
Tertiary Structure: The three-dimensional structure of the protein, influenced by interactions between R groups, including hydrophobic interactions, ionic bonds, and hydrogen bonds .
Quaternary Structure: The arrangement of multiple polypeptide chains in a multi-subunit protein .
The presence of a BTB/POZ domain suggests MIMI_R224 is involved in protein-protein interactions and possibly transcriptional regulation . BTB/POZ domains are known to mediate homo- and hetero-oligomerization, which is crucial for various cellular processes.
Recombinant MIMI_R224 is produced in E. coli with an N-terminal His tag for purification purposes . Key characteristics of the recombinant protein include:
Recombinant MIMI_R224 can be utilized in various research applications:
ELISA assays: Recombinant MIMI_R224 can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify antibodies against the mimivirus in biological samples .
Protein interaction studies: The BTB/POZ domain makes it suitable for studying protein-protein interactions .
Structural studies: Determining the three-dimensional structure of MIMI_R224 can provide insights into its function and interactions .
Functional assays: Investigating the role of MIMI_R224 in viral replication and host cell interactions.
When presenting research findings related to MIMI_R224, it is essential to follow established guidelines for clarity and accuracy .
Tables: Tables should be comprehensible without reference to the main text, with clear titles and descriptive column heads . Units of each variable should be defined, and the sample size of each group should be indicated .
Figures: Figures should be clear and informative, with concise legends .
Results Section: The sequence of results should be logical, and any references should be avoided in this section . Insignificant changes should not be described using terms like "increased" or "decreased" .
KEGG: vg:9924831
MIMI_R224 is a putative BTB/POZ domain-containing protein encoded by the Acanthamoeba polyphaga mimivirus genome. BTB/POZ domains are protein-protein interaction motifs that primarily function in transcriptional regulation through homo- and heterodimerization . Within the mimivirus context, MIMI_R224 likely participates in protein complex formation critical for viral replication and transcriptional control. Similar to other BTB domain proteins identified in viruses, it may modulate host-pathogen interactions by interacting with host transcriptional machinery or other viral proteins during infection cycles.
Structural analysis reveals that MIMI_R224, like other BTB/POZ domain proteins, likely forms obligate dimers stabilized primarily through electrostatic interactions and hydrophobic forces . While some BTB domain proteins such as BACH2 contain disulfide bonds that stabilize their homodimeric structure, molecular dynamics simulations indicate that MIMI_R224 relies predominantly on non-covalent interactions for dimer stability . The dimerization interface typically involves the α1 helix, β1 strand, α2 helix, and β2 strand of the BTB domain, creating a characteristic fold that facilitates protein-protein interactions critical for function.
Based on studies of mimivirus replication, MIMI_R224 likely follows the temporal expression pattern observed for other viral proteins involved in transcriptional regulation. Similar to other mimivirus proteins found within virions, MIMI_R224 may be expressed early during infection and packaged into new virions . The presence of transcriptional regulators within mimivirus particles suggests their importance in the early stages of infection, potentially priming host machinery for viral replication before viral gene expression begins . Quantitative PCR and transcriptomic analyses throughout the infection cycle would be required to precisely map MIMI_R224 expression patterns.
For recombinant expression of MIMI_R224, a bacterial expression system using E. coli BL21(DE3) with a pET-based vector containing an N-terminal His-tag is recommended. Expression should be induced with 0.5-1.0 mM IPTG at 18°C overnight to minimize inclusion body formation. For purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin followed by size exclusion chromatography effectively isolates the protein.
The following purification protocol yields high-purity protein:
| Purification Step | Buffer Composition | Conditions | Expected Yield |
|---|---|---|---|
| Cell Lysis | 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT | Sonication or French press | - |
| IMAC | Same as lysis + 20-250 mM imidazole gradient | 4°C, flow rate 1 ml/min | 15-20 mg/L culture |
| Size Exclusion | 20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTT | Superdex 200 column | 10-15 mg/L culture |
Protein stability is enhanced with the addition of 10% glycerol to storage buffers, and aliquots should be flash-frozen in liquid nitrogen for long-term storage at -80°C.
Multiple complementary approaches should be employed to thoroughly characterize MIMI_R224 dimerization:
For in vitro assessment:
Analytical size exclusion chromatography comparing elution volumes with known standards
Dynamic light scattering to determine hydrodynamic radius
Analytical ultracentrifugation for precise molecular weight determination
Isothermal titration calorimetry to quantify binding thermodynamics
For cellular contexts, the fluorescent two-hybrid assay (F2H) has proven effective for BTB domain proteins . This approach involves:
Tagging MIMI_R224 with fluorescent proteins (e.g., tagGFP and tagRFP)
Expressing these constructs in mammalian cells
Visualizing interaction through fluorescence microscopy, where co-localization of fluorescent signals indicates dimerization
Cross-linking studies using reagents like BS3 or formaldehyde followed by SDS-PAGE and western blot analysis can further confirm dimerization in cellular extracts.
A multi-faceted approach is necessary to comprehensively map MIMI_R224 host protein interactions:
Affinity Purification-Mass Spectrometry (AP-MS): Express tagged MIMI_R224 in amoeba cells, perform pull-downs, and identify binding partners by LC-MS/MS. This approach identified mimivirus proteins L442, L724, L829, R387 and R135 in previous studies .
Proximity-Based Labeling: BioID or APEX2 fusion proteins can identify transient or weak interactions through proximity-dependent biotinylation.
Yeast Two-Hybrid Screening: Using amoeba cDNA libraries to identify potential interactors, followed by validation.
Co-immunoprecipitation: With antibodies against MIMI_R224 or potential host targets.
For validation and characterization of identified interactions:
Surface plasmon resonance (SPR) to determine binding kinetics
ELISA-based binding assays for interaction specificity
Cellular co-localization studies using fluorescently-tagged proteins
Functional assays to assess the biological significance of interactions
Obtaining the crystal structure of MIMI_R224's BTB/POZ domain requires a systematic approach:
Construct Optimization: Create several constructs with varying domain boundaries based on secondary structure predictions and disorder analysis.
Protein Production: Express and purify protein as described in section 2.1, ensuring monodispersity by dynamic light scattering.
Crystallization Screening: Employ commercial sparse matrix screens (Hampton Research, Molecular Dimensions) at protein concentrations of 5-15 mg/ml using sitting-drop vapor diffusion at both 4°C and 18°C.
Optimization: Refine promising conditions by varying precipitant concentration, pH, and additives.
Data Collection: Collect X-ray diffraction data at synchrotron radiation facilities.
Structure Determination: Use molecular replacement with known BTB domain structures as search models , followed by iterative model building and refinement.
If crystallization proves challenging, consider alternative approaches such as NMR spectroscopy for smaller constructs or cryo-electron microscopy for larger assemblies.
Multiple computational strategies can provide insights into MIMI_R224 functions:
Homology Modeling: Using Phyre2 as employed for other mimivirus proteins to predict three-dimensional structure based on known BTB/POZ domains.
Molecular Dynamics Simulations: To analyze the stability of predicted homo- and heterodimers, identifying key residues involved in dimerization .
Protein-Protein Docking: Tools like HADDOCK or ClusPro to model interactions with potential partners.
Sequence-Based Predictions:
Conserved domain analysis
Prediction of post-translational modifications
Identification of short linear motifs that may mediate protein interactions
Evolutionary Analysis: Examining conservation patterns across mimivirus strains and related giant viruses to identify functionally important regions.
Gene Expression Correlation Analysis: Similar to the approach used for ZBTB proteins , analyzing co-expression patterns with other mimivirus genes to predict functional relationships.
Based on studies of other BTB/POZ domain proteins, dimerization specificity varies considerably. In the ZBTB family, all tested BTB domains can form homodimers, while heterodimer formation is rare, with only a single pair identified in comprehensive testing . This suggests MIMI_R224 likely has a strong preference for homodimerization.
Dimerization specificity is determined by:
Interface Complementarity: The shape and charge distribution at the dimerization interface
Key Residues: Specific amino acids at the interface that determine compatibility
Stabilizing Forces: The balance of electrostatic, hydrophobic, and hydrogen-bonding interactions
Experimental determination of MIMI_R224's dimerization preferences would require:
Construction of a dimerization matrix similar to that reported for ZBTB proteins
Quantitative measurement of binding affinities using methods like isothermal titration calorimetry
Mutational analysis to identify specificity-determining residues
To investigate MIMI_R224's potential role in transcriptional regulation, establish an in vitro transcription system with the following components:
Template Preparation:
Design DNA templates containing putative binding sites based on motif analysis
Include control templates with mutated binding sites
Protein Components:
Purified recombinant MIMI_R224
RNA polymerase (either viral or host-derived)
General transcription factors from host
Transcription Assay Setup:
| Component | Concentration | Purpose |
|---|---|---|
| Template DNA | 10-20 nM | Transcription substrate |
| MIMI_R224 | 10-500 nM | Test protein |
| RNA polymerase | 50-100 nM | Transcription enzyme |
| NTPs | 0.5 mM each | Substrates for RNA synthesis |
| Buffer | 20 mM HEPES pH 7.9, 100 mM KCl, 10 mM MgCl₂, 0.1 mM EDTA, 1 mM DTT | Reaction environment |
Analysis Methods:
Quantify transcript levels using radiolabeled nucleotides or fluorescent detection
Analyze transcripts by gel electrophoresis or capillary electrophoresis
Perform kinetic analyses to determine the effect of MIMI_R224 on transcription rates
Controls:
Include reactions without MIMI_R224 to establish baseline transcription
Use known transcriptional regulators as positive controls
Test mutated versions of MIMI_R224 to identify functional domains
Determining the essentiality of MIMI_R224 for mimivirus replication requires several complementary approaches:
Genetic Manipulation:
CRISPR-Cas9 genome editing of the mimivirus genome to disrupt the R224 gene
Construction of conditional mutants using inducible systems
Complementation studies with wild-type protein to confirm phenotypes
Microinjection-Based Approach:
Dominant Negative Approaches:
Express mutated versions of MIMI_R224 designed to interfere with wild-type function
Assess the impact on viral replication kinetics
Small Molecule Inhibitors:
Develop or identify compounds that specifically target MIMI_R224 function
Test their effect on viral replication in culture
Quantitative Assessment:
A comprehensive investigation of MIMI_R224's mode of action requires multiple experimental approaches:
DNA Binding Assays:
Electrophoretic mobility shift assays (EMSA) with labeled DNA fragments
DNase I footprinting to identify specific binding sites
Chromatin immunoprecipitation (ChIP) to identify genomic binding sites in infected cells
Systematic evolution of ligands by exponential enrichment (SELEX) to determine binding motifs
Structural Studies:
X-ray crystallography or cryo-EM of MIMI_R224 in complex with DNA
NMR spectroscopy to map interaction surfaces
Hydrogen-deuterium exchange mass spectrometry to identify regions protected upon DNA binding
Protein Interaction Mapping:
Yeast two-hybrid or mammalian two-hybrid assays
Co-immunoprecipitation followed by mass spectrometry
Proximity labeling approaches (BioID, APEX)
Functional Analysis:
Mutagenesis of predicted DNA-binding residues versus protein-interaction surfaces
Domain swapping experiments with other BTB/POZ proteins
In vitro transcription assays with purified components
Cellular Localization:
Fluorescence microscopy of tagged MIMI_R224 during infection
Co-localization with DNA or other proteins
Live cell imaging to track dynamics during viral replication cycle
Current research on MIMI_R224 faces several significant challenges:
Technical Limitations:
Knowledge Gaps:
Absence of structural data for many mimivirus proteins
Limited understanding of BTB/POZ domain functions in viral contexts
Unclear regulatory networks within the mimivirus genome
Development of improved microinjection techniques specifically designed for amoeba, accounting for their unique adhesion properties
Adaptation of CRISPR-Cas systems for giant virus genome editing
Creation of amoeba cell lines stably expressing fluorescent markers for improved visualization
Application of single-cell transcriptomics to track host responses to wild-type versus R224-mutant viruses
Development of in vitro systems reconstituting mimivirus transcription machinery
MIMI_R224 likely exhibits unique features compared to BTB/POZ domains in other systems:
Evolutionary Context:
Viral BTB/POZ domains may have been acquired from hosts but evolved distinct functions
Potential horizontal gene transfer between giant viruses and their hosts creates unique evolutionary pressures
Functional Adaptations:
While cellular BTB/POZ proteins often function in transcriptional repression, viral versions may have evolved to manipulate host pathways
MIMI_R224 may interface with amoeba-specific factors not targeted by other BTB/POZ proteins
Potential roles in viral packaging or assembly unique to the mimivirus context
Structural Considerations:
MIMI_R224 may form different multimeric assemblies beyond the typical dimers seen in cellular BTB/POZ proteins
Viral protein interfaces might be optimized for transient rather than stable interactions
Host-Pathogen Interactions:
MIMI_R224 may function at the interface between viral and host processes
Potential involvement in immune evasion mechanisms specific to amoeba hosts
Several cutting-edge high-throughput approaches could significantly accelerate research on MIMI_R224:
Proteome-Wide Interaction Mapping:
BioID or APEX2 proximity labeling coupled with mass spectrometry
Protein microarrays featuring host and viral proteins
Crosslinking mass spectrometry (XL-MS) to capture transient interactions
Functional Genomics:
CRISPR-Cas9 screening of host factors that interact with MIMI_R224
Saturating mutagenesis of MIMI_R224 coupled with viral fitness assays
Synthetic genetic array analysis to identify genetic interactions
Structural Genomics:
Cryo-electron microscopy of MIMI_R224 in different functional states
High-throughput crystallization of MIMI_R224 with various binding partners
Integrative structural biology combining multiple data types
Systems Biology Approaches:
Temporal proteomics during infection with wild-type versus R224-mutant viruses
Metabolomics to identify changes in host metabolism
Network analysis integrating multiple omics datasets
Advanced Imaging:
Super-resolution microscopy to track MIMI_R224 during infection
Correlative light and electron microscopy (CLEM) to visualize MIMI_R224 in the context of viral structures
Live-cell imaging with tagged proteins to monitor dynamic interactions