Recombinant Acanthamoeba polyphaga mimivirus Putative GMC-type oxidoreductase R135 (MIMI_R135)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Acanthamoeba polyphaga mimivirus Putative GMC-type oxidoreductase R135 (MIMI_R135) is a protein derived from the Acanthamoeba polyphaga mimivirus (APMV) . It is classified as a putative GMC-type oxidoreductase, with the Enzyme Commission number EC 1.-.-.- .

Source and Production

MIMI_R135 is produced recombinantly in various expression systems, including:

  • Yeast

  • E. coli

  • Baculovirus

  • Mammalian cells

Characteristics

MIMI_R135 is a protein with a full length of 702 amino acids . The protein contains a putative GMC-type oxidoreductase domain, suggesting it may be involved in oxidoreduction processes . The precise function and structure of MIMI_R135 can be predicted using bioinformatics tools available on the web .

Amino Acid Sequence

The amino acid sequence of MIMI_R135 is as follows :
MKNKECCKCYNPCEKICVNYSTTDVAFERPNPCKPIPCKPTPIPCDPCHNTKDNLTGDIVIIGAGAAGSLLAHYLARFSNMKIILLEAGHSHFNDPVVTDPMGFFGKYNPPNENISMSQNPSYSWQGAQEPNTGAYGNRPIIAHGMGFGGSTMINRLNLVVGGRTVFDNDWPVGWKYDDVKNYFRRVLVDINPVRDNTKASITSVALDALRIIAEQQIASGEPVDFLLNKATGNVPNVEKTTPDAVPLNLNDYEGVNSVVAFSSFYMGVNQLSDGNYIRKYAGNTYLNRNYVDENGRGIGKFSGLRVVSDAVVDRIIFKGNRAVGVNYIDREGIMHYVKVNKEVVVTSGAFYTPTILQRSGIGDFTYLSSIGVKNLVYNNPLVGTGLKNHYSPVTITRVHGEPSEVSRFLSNMAANPTNMGFKGLAELGFHRLDPNKPANANTVTYRKYQLMMTAGVGIPAEQQYLSGLSPSSNNLFTLIADDIRFAPEGYIKIGTPNIPRDVPKIFFNTFVTYTPTSAPADQQWPIAQKTLAPLISALLGYDIIYQTLMSMNQTARDSGFQVSLEMVYPLNDLIYKLHNGLATYGANWWHYFVPTLVGDDTPAGREFADTLSKLSYYPRVGAHLDSHQGCSCSIGRTVDSNLKVIGTQNVRVADLSAAAFPPGGNTWATASMIGARAVDLILGFPYLRDLPVNDVPILNVN.

Applications

MIMI_R135 is used in various research applications. It is available for purchase as a recombinant protein for use in Enzyme-Linked Immunosorbent Assays (ELISA) .

Data Representation

Tables are useful for organizing detailed and complex data, allowing readers to quickly understand results .

Available Forms

MIMI_R135 is available in several forms :

  • Non-conjugated

  • Avi-tag Biotinylated: This form is biotinylated in vivo using AviTag-BirA technology, where the E. coli biotin ligase (BirA) catalyzes the attachment of biotin to the AviTag peptide .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_R135; Putative GMC-type oxidoreductase R135
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-702
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R135
Target Protein Sequence
MKNKECCKCYNPCEKICVNYSTTDVAFERPNPCKPIPCKPTPIPCDPCHNTKDNLTGDIV IIGAGAAGSLLAHYLARFSNMKIILLEAGHSHFNDPVVTDPMGFFGKYNPPNENISMSQN PSYSWQGAQEPNTGAYGNRPIIAHGMGFGGSTMINRLNLVVGGRTVFDNDWPVGWKYDDV KNYFRRVLVDINPVRDNTKASITSVALDALRIIAEQQIASGEPVDFLLNKATGNVPNVEK TTPDAVPLNLNDYEGVNSVVAFSSFYMGVNQLSDGNYIRKYAGNTYLNRNYVDENGRGIG KFSGLRVVSDAVVDRIIFKGNRAVGVNYIDREGIMHYVKVNKEVVVTSGAFYTPTILQRS GIGDFTYLSSIGVKNLVYNNPLVGTGLKNHYSPVTITRVHGEPSEVSRFLSNMAANPTNM GFKGLAELGFHRLDPNKPANANTVTYRKYQLMMTAGVGIPAEQQYLSGLSPSSNNLFTLI ADDIRFAPEGYIKIGTPNIPRDVPKIFFNTFVTYTPTSAPADQQWPIAQKTLAPLISALL GYDIIYQTLMSMNQTARDSGFQVSLEMVYPLNDLIYKLHNGLATYGANWWHYFVPTLVGD DTPAGREFADTLSKLSYYPRVGAHLDSHQGCSCSIGRTVDSNLKVIGTQNVRVADLSAAA FPPGGNTWATASMIGARAVDLILGFPYLRDLPVNDVPILNVN
Uniprot No.

Target Background

Gene References Into Functions
  1. R135 may be involved in viral entry, potentially through the degradation of host cells, including certain lignin-containing algae. PMID: 25982526
Database Links

KEGG: vg:9924735

Protein Families
GMC oxidoreductase family
Subcellular Location
Virion. Host membrane; Single-pass membrane protein.

Q&A

What role does MIMI_R135 play in mimivirus infection?

MIMI_R135 plays multiple crucial roles in mimivirus infection cycles:

  • Viral entry and adhesion: The protein is a glycosylated component of mimivirus fibrils, which are surface structures that mediate strong adhesion to host cells through glycan interactions, specifically mannose and N-acetylglucosamine . This adhesion capability is essential for initial attachment to amoebae hosts.

  • Virion generation: Transfection experiments have revealed that MIMI_R135 is one of at least four proteins (along with L442, L724, L829, and R387) needed for the successful generation of infectious APMV virions following DNA transfection into Acanthamoeba castellanii .

  • Redox regulation: As a putative GMC-type oxidoreductase, MIMI_R135 likely participates in oxidation-reduction reactions during viral infection, potentially affecting cellular redox balance in ways that favor viral replication .

  • Virophage interactions: MIMI_R135 has been found in the protein panel of the virophage Sputnik, suggesting a role in virus-virophage interactions . Without the adhesion capability provided by fibrils containing R135, mimiviruses cannot effectively interact with virophages .

  • Protein expression regulation: MIMI_R135 was found to be upregulated when the R458 gene (involved in translation initiation) was silenced, indicating its involvement in compensatory mechanisms related to viral protein synthesis .

What are the recommended protocols for recombinant MIMI_R135 production?

The production of recombinant MIMI_R135 involves several standardized steps:

  • Expression system selection: E. coli has been successfully employed as an expression system for MIMI_R135 . This bacterial system provides high yield and straightforward purification options.

  • Construct design: The full-length protein (1-702 amino acids) can be expressed with an N-terminal His tag to facilitate purification . The gene sequence should be codon-optimized for the expression host.

  • Expression conditions:

    • Induction with IPTG (0.5-1.0 mM) when bacterial culture reaches OD600 of 0.6-0.8

    • Expression at 16-25°C for 16-18 hours to minimize inclusion body formation

    • Use of enriched media such as TB or 2xYT to maximize protein yield

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Gradient elution with imidazole (20-250 mM)

    • Size exclusion chromatography for final purification

  • Quality control:

    • SDS-PAGE analysis (>90% purity is achievable)

    • Western blotting with anti-His antibodies

    • Activity assays to confirm oxidoreductase function

What are the optimal storage conditions for recombinant MIMI_R135?

Proper storage is critical for maintaining MIMI_R135 stability and activity:

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been determined to be optimal for maintaining protein stability .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Storage temperature:

    • Store at -20°C/-80°C upon receipt

    • Working aliquots can be kept at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Aliquoting strategy: Divide into single-use aliquots immediately after reconstitution to prevent degradation from repeated freeze-thaw cycles.

How can MIMI_R135 be used to study mimivirus-host interactions?

MIMI_R135 provides several methodological approaches for investigating mimivirus-host interactions:

  • Microinjection studies: Direct transfection of purified MIMI_R135 with viral DNA into Acanthamoeba cells can help evaluate its role in early infection processes . This technique allows for controlled delivery of specific viral components to determine their sufficiency for virion generation.

    Methodology:

    • Prepare amoeba cells at 10³ cells/ml in starvation medium

    • Plate 2 ml of cell suspension in imaging dishes (glass-bottomed)

    • Use femtotips for microinjection under fluorescence microscopy guidance

    • Monitor cell viability and viral production using rhodamine-dextran dye

  • Protein-glycan interaction assays: Since MIMI_R135 is involved in fibril-mediated adhesion through glycans, researchers can employ:

    • Glycan microarray analysis

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

  • Immunolocalization experiments: Using antibodies against MIMI_R135 to track its location during different stages of infection can reveal temporal and spatial dynamics.

  • Selective inhibition studies: Developing specific inhibitors of MIMI_R135 oxidoreductase activity to assess impact on:

    • Viral attachment efficiency

    • Infection progression

    • Virion assembly and maturation

    • Host cell redox balance

  • Comparative proteomics: Analysis of host protein expression changes in response to wild-type virus versus MIMI_R135-deficient variants.

What methodologies can be used to investigate MIMI_R135's oxidoreductase activity?

As a putative GMC-type oxidoreductase, several approaches can elucidate MIMI_R135's enzymatic activity:

  • Spectrophotometric assays:

    • Monitor FAD/NAD(P)H oxidation at 340nm

    • Hydrogen peroxide production using coupled peroxidase assays

    • Oxygen consumption via polarographic methods

  • Substrate screening panel:

    • Glucose oxidation assay

    • Methanol oxidation assay

    • Choline oxidation assay

    • Other potential substrates based on host metabolites

  • Redox potential measurement:

    • Cyclic voltammetry

    • Potentiometric titration

    • Electron paramagnetic resonance (EPR) for radical detection

  • Kinetic parameter determination:

    • Km and Vmax under varying pH and temperature conditions

    • Inhibitor studies to determine mechanism

    • Cofactor requirements and specificity

  • Comparative activity assessments:

    SubstrateRelative Activity (%)Km (mM)Optimal pHOptimal Temperature (°C)
    Glucose100 (reference)TBDTBDTBD
    MethanolTBDTBDTBDTBD
    CholineTBDTBDTBDTBD

    Note: The table framework is provided for researchers to populate with experimental data.

How does MIMI_R135 compare to other viral and non-viral GMC-type oxidoreductases?

Comparative analysis of MIMI_R135 with other GMC oxidoreductases reveals important evolutionary and functional insights:

  • Structural comparison:

    • MIMI_R135 shares the characteristic adenine-dinucleotide-phosphate-binding βαβ-fold found in other GMC oxidoreductases

    • Unlike bacterial GMC oxidoreductases like E. coli choline dehydrogenase, MIMI_R135 has unique viral-specific structural elements

  • Phylogenetic relationships:

    • MIMI_R135 has homologs exclusively in the three lineages of mimivirus (A, B, and C)

    • Phylogenetic analysis suggests it was present in the common ancestor of these lineages

    • It represents a distinct evolutionary branch compared to prokaryotic and eukaryotic GMC oxidoreductases

  • Functional comparison:

    • While bacterial GMC oxidoreductases like those in E. coli function in osmoprotection , MIMI_R135 functions in viral adhesion and infection

    • GMC oxidoreductases in leaf beetles provide chemical defenses , whereas MIMI_R135 facilitates host cell invasion

    • Unlike rhizobial GMC oxidoreductases that function in nitrogen fixation and oxidative stress protection , MIMI_R135 appears specialized for viral-host interactions

  • Substrate specificity:

    • MIMI_R135 likely has different substrate specificities compared to characterized GMC oxidoreductases from A. niger (glucose), H. polymorpha (methanol), and E. coli (choline)

    • Experimental determination of substrate preference would be a valuable contribution to the field

What gene silencing approaches can be used to study MIMI_R135 function?

Several gene silencing techniques can be applied to investigate MIMI_R135 function:

  • RNA interference (RNAi):

    • Design specific siRNAs targeting MIMI_R135 mRNA

    • Transfect siRNAs into infected amoeba cells

    • Monitor changes in viral replication, structure, and host interaction

    • This approach has been successfully used for other mimivirus genes like R458

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting MIMI_R135 gene

    • Engineer viral genome using in vitro CRISPR-Cas9 systems

    • Transfect modified viral DNA into amoeba cells

    • Validate editing and assess phenotypic changes

  • Antisense oligonucleotides:

    • Design phosphorothioate-modified DNA oligonucleotides complementary to MIMI_R135 mRNA

    • Introduce during infection process

    • Quantify knockdown efficiency using qRT-PCR and Western blotting

  • Dominant negative mutants:

    • Engineer catalytically inactive MIMI_R135 variants

    • Express during viral infection

    • Assess competition with native protein

  • Protein knockout validation:

    • Confirm protein absence using targeted proteomics

    • Employ complementation assays to verify specificity

    • Use genome sequencing to confirm genetic modification

Previous studies silencing the R458 gene showed deregulation of 32 proteins, including MIMI_R135, demonstrating the interconnected nature of viral gene expression networks .

What is the significance of MIMI_R135's interaction with virophages?

MIMI_R135's interaction with virophages represents a fascinating aspect of viral parasitism and has several important research implications:

  • Molecular basis of virus-virophage interactions:

    • MIMI_R135 has been found in the protein panel of the virophage Sputnik

    • The fibrils containing R135 mediate adhesion not only to host amoebae but also to virophages

    • Without this adhesion capability, mimiviruses cannot effectively interact with virophages

  • Experimental approaches to study these interactions:

    • Co-immunoprecipitation to identify direct binding partners in Sputnik

    • Fluorescence resonance energy transfer (FRET) to visualize protein-protein interactions

    • Yeast two-hybrid screening to map interaction domains

    • Cryo-electron microscopy to visualize structural interfaces

  • Functional consequences:

    • Impact on mimivirus replication when Sputnik is present

    • Changes in oxidoreductase activity during co-infection

    • Potential competition for shared resources

    • Altered host cell responses to co-infection

  • Evolutionary implications:

    • Selective pressures on MIMI_R135 conservation

    • Co-evolutionary dynamics between mimivirus and virophages

    • Horizontal gene transfer possibilities

    • Development of resistance mechanisms

This interaction represents a model system for understanding virus-virus interactions and the evolution of viral defense mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.