Recombinant Acanthamoeba polyphaga mimivirus Putative TLC domain-containing protein L438 (MIMI_L438)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

MIMI_L438 is expressed in Escherichia coli with an N-terminal His-tag for purification . Production specifications include:

ParameterDetails
Expression SystemE. coli
TagHis-tag
Purity>90% (verified by SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with glycerol for stability

Biochemical Properties

Recombinant MIMI_L438 exhibits stability under specific storage conditions but is sensitive to repeated freeze-thaw cycles:

PropertyDetails
StabilityStable at 4°C for 1 week; long-term storage requires -20°C/-80°C
Buffer CompositionTris-based buffer with 50% glycerol
Isoelectric Point (pI)Not experimentally determined; predicted via sequence analysis

Functional Insights

MIMI_L438 is classified as a virion-associated protein, though its precise role in Mimivirus biology is understudied. Key contextual findings include:

  • Virion Structure: Mimivirus particles contain >137 proteins, many with unknown functions. MIMI_L438 is among these, potentially contributing to capsid assembly or membrane interactions .

  • TLC Domain: Homologous TLC domains in other organisms mediate lipid transfer or signaling, suggesting MIMI_L438 could participate in viral membrane dynamics .

  • Research Gaps: No direct enzymatic or structural studies on MIMI_L438 exist, though its presence in virions implies a structural or regulatory role .

Applications in Research

Recombinant MIMI_L438 is primarily utilized in:

  1. ELISA Development: Commercial sources list it as an antigen for antibody generation and immunoassays .

  2. Protein Interaction Studies: Potential use in pull-down assays to identify host or viral binding partners.

  3. Structural Biology: Crystallization or cryo-EM studies to resolve its tertiary structure and domain function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIMI_L438; Putative TLC domain-containing protein L438
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L438
Target Protein Sequence
MDYKQSNLFLFPIGLGSTYIFYKKICGTFCSIDNDLEVNPYLTHGILMLTLVYFLSDYYL MIVKYNPKHNVYFVHHFIGIVSIYFSYMKYYYLIKYLFAYLTFELSTPFLNIAIKYRNQG VYNKCSIFSELAFFILFTVVRIIFGTYLWFVTSNTLSSIEYPYNYLIVLPTILQFLNYWW YYRILKILRAKLFGCINKED
Uniprot No.

Target Background

Database Links

KEGG: vg:9925062

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of TLC domain-containing proteins in Acanthamoeba polyphaga mimivirus?

TLC domain-containing proteins in mimivirus are believed to play important roles in DNA-protein interactions during viral replication. Based on studies of similar mimivirus proteins, such as L442, these proteins likely associate with the viral DNA and are critical for successful viral replication after infection. In experimental settings, when DNA-associated proteins are removed through treatments like proteinase K digestion, the ability to generate infectious virions is dramatically reduced, suggesting these proteins are essential for the viral life cycle . Similar to protein L442, L438 may be part of a complex of DNA-associated proteins that facilitate viral genome replication or packaging.

How does MIMI_L438 compare structurally to other mimivirus proteins?

While specific structural data for L438 is limited, we can draw parallels with related mimivirus proteins that have been studied more extensively. For instance, uncharacterized proteins like L442, L724, L829, and R387 have been identified through proteomic analysis as DNA-associated proteins in mimivirus . Tertiary structure prediction using tools such as Phyre2 has been employed for these proteins, which could similarly be applied to L438 to predict its structure and potential functional domains. Proteomic analyses suggest these proteins may work in concert during viral replication processes, potentially forming protein-DNA complexes essential for viral production.

What experimental approaches are commonly used to study mimivirus proteins like L438?

Common experimental approaches include:

  • Protein extraction and purification from purified viral particles

  • SDS-PAGE analysis for protein visualization

  • Mass spectrometry (MALDI-TOF-MS and LC-MS) for protein identification

  • Gene silencing using siRNA to study protein function

  • Comparative proteomics using techniques like two-dimensional difference-in-gel electrophoresis (2D-DIGE)

  • Tertiary structure prediction using bioinformatics tools like Phyre2

  • DNA transfection experiments to assess protein roles in viral replication

These methods have successfully identified and characterized several mimivirus proteins and could be applied to study L438 specifically.

How do DNA-associated proteins like L438 contribute to mimivirus infection mechanisms?

Based on research with similar mimivirus proteins, DNA-associated proteins likely play critical roles in multiple stages of viral infection. Studies have shown that when mimivirus DNA is microinjected into Acanthamoeba castellanii without its associated proteins (through proteinase K treatment), infectious virions fail to be produced, suggesting these proteins are essential for viral replication .

For L438 specifically, its putative TLC domain may indicate involvement in:

  • DNA packaging within the viral capsid

  • Protection of viral DNA from host nucleases

  • Facilitation of early transcription events upon infection

  • Recruitment of host or viral factors necessary for replication

Similar proteins, such as L442, have been implicated in these processes, with experimental evidence showing their necessity for successful viral production after DNA transfection into host cells .

What is the relationship between translation initiation factors and proteins like L438 in mimivirus replication?

Research on the mimivirus translation initiation factor 4a (protein R458) provides insights into how translation regulation affects other viral proteins. When R458 is silenced using siRNA, it causes deregulation of 32 different viral proteins . Interestingly, proteins with functions similar to L438, including uncharacterized proteins L442, L724, and L829 as well as putative GMC oxidoreductase R135, are among those deregulated .

This suggests a potential regulatory network where translation factors like R458 control the expression of DNA-associated proteins, which in turn affect viral replication efficiency. For TLC domain-containing proteins like L438, this relationship could be particularly important as proper timing and levels of expression may be critical for their function in the viral life cycle.

How does protein L438 interact with the viral genome compared to other DNA-associated proteins such as L442?

While direct comparative data between L438 and L442 is limited in the available literature, we can hypothesize based on what is known about L442. Protein L442 has been identified as a DNA-associated protein that remains bound to extracted mimivirus DNA and is necessary for generating infectious virions after DNA transfection .

The interaction patterns may include:

  • Sequence-specific binding to particular regions of the viral genome

  • Non-specific binding to stabilize DNA structure

  • Facilitation of DNA packaging into viral capsids

  • Protection of viral DNA from host nucleases

Research methodologies to investigate these interactions could include:

  • Chromatin immunoprecipitation (ChIP) assays to identify specific DNA binding sites

  • Electrophoretic mobility shift assays (EMSA) to characterize binding properties

  • X-ray crystallography of protein-DNA complexes to determine precise binding mechanisms

What is the impact of L438 silencing on viral fitness and protein expression profiles?

Based on studies of similar proteins, silencing L438 would likely impact viral fitness. For example, when translation initiation factor R458 was silenced, researchers observed a significant delay in the viral eclipse phase, extending it from 4-7 hours post-infection in wild-type virus to 9+ hours in silenced virus . While the final viral particle production remained unchanged, the growth rate was significantly decreased.

A comparable experiment specifically targeting L438 would likely show:

  • Altered viral replication kinetics

  • Changes in the expression profile of other viral proteins

  • Potential impacts on viral factory formation

  • Possible effects on viral DNA packaging or stability

To quantify these effects, methods such as comparative proteomics using 2D-DIGE, immunofluorescence microscopy to track viral factory formation, and qPCR to measure viral replication rates would be valuable experimental approaches .

What are the most effective methods for extracting and purifying L438 protein from mimivirus?

Based on established protocols for mimivirus protein extraction, an effective methodology for L438 purification would include:

  • Virus Production and Purification:

    • Culture Acanthamoeba castellanii at 5 × 10^5 cells/ml in PYG medium at 28°C

    • Infect with mimivirus at MOI of 10

    • Incubate at 30°C until complete lysis is observed

    • Filter supernatant through 0.8-μm-pore filters to eliminate debris

    • Centrifuge at 14,000 × g for 45 min

    • Purify virus by ultracentrifugation at 14,000 × g for 45 min across a 25% sucrose layer

  • Protein Extraction:

    • Extract DNA from purified virus using commercial kits (e.g., EZ1 DNA Tissue Kit)

    • Analyze DNA-associated proteins by SDS-PAGE

    • Identify specific bands containing L438 using mass spectrometry

    • For further purification, employ column chromatography techniques based on protein properties

  • Confirmation:

    • Confirm protein identity using MALDI-TOF-MS or LC-MS

    • Validate purity using SDS-PAGE and Western blotting

This protocol is adapted from successful methodologies used for other mimivirus proteins and should be effective for L438 isolation .

How can researchers effectively silence L438 gene expression to study its function?

Based on successful gene silencing strategies employed for other mimivirus proteins, the following methodology would be effective for L438:

  • siRNA Design and Synthesis:

    • Design siRNA duplexes specifically targeting the L438 gene sequence

    • Include fluorescent labeling for transfection confirmation

    • Synthesize control siRNAs with scrambled sequences

  • Transfection Protocol:

    • Infect A. polyphaga with mimivirus

    • At 1-2 hours post-infection, transfect cells with L438-siRNA using Lipofectamine

    • Confirm transfection by fluorescence microscopy at 3 hours post-infection

    • Extract RNA at 6 hours post-infection to verify silencing efficiency by RT-PCR

  • Validation and Analysis:

    • Compare mRNA expression levels between wild-type and silenced mimivirus

    • Monitor viral development cycle using immunofluorescence microscopy

    • Quantify viral production using qPCR and flow cytometry

    • Conduct comparative proteomic analysis using 2D-DIGE to identify deregulated proteins

This methodology has proven effective for silencing other mimivirus genes, with observable impacts on viral growth kinetics and protein expression profiles .

What techniques can be used to study L438 interactions with viral DNA and other proteins?

Several complementary techniques can be employed to characterize L438 interactions:

  • DNA-Protein Interaction Studies:

    • Chromatin immunoprecipitation (ChIP) to identify DNA binding sites

    • Electrophoretic mobility shift assays (EMSA) to characterize binding affinity

    • DNase footprinting to identify protected DNA regions

    • DNA transfection experiments with and without the presence of L438

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation (Co-IP) to identify protein complexes

    • Yeast two-hybrid screening to identify interaction partners

    • Proximity ligation assays (PLA) for in situ detection of interactions

    • Mass spectrometry of purified protein complexes

  • Structural Studies:

    • X-ray crystallography of L438 alone and in complex with DNA or proteins

    • Nuclear magnetic resonance (NMR) for solution structure determination

    • Cryo-electron microscopy for visualization of larger complexes

  • Functional Assays:

    • Microinjection of viral DNA with and without L438 to assess its requirement for virion production

    • Comparison of proteinase K-treated versus untreated DNA in transfection experiments

These techniques would provide comprehensive insights into L438's molecular interactions and functional role in the viral life cycle.

How should researchers interpret proteomics data when studying L438 expression changes?

When analyzing proteomics data for L438 expression changes, researchers should follow these methodological guidelines:

  • Data Normalization and Statistical Analysis:

    • Normalize spot volumes using internal standards

    • Apply appropriate statistical tests (t-tests or ANOVA) with correction for multiple testing

    • Consider a protein significantly deregulated when p < 0.05 and fold change > 1.5

  • Classification of Expression Patterns:

    • Categorize proteins as upregulated or downregulated

    • Group deregulated proteins by functional categories (e.g., structural proteins, transcriptional machinery, oxidative pathways)

    • Compare expression profiles across different time points or conditions

  • Contextual Interpretation:

    Expression PatternPotential Biological Significance
    Upregulation of L438Possible compensation for deficiency in related proteins
    Downregulation of L438Potential disruption of DNA packaging or protection
    Co-regulation with structural proteinsRole in virion assembly
    Co-regulation with transcription factorsRole in gene expression regulation
  • Integration with Other Data Types:

    • Correlate proteomics findings with phenotypic observations

    • Integrate with transcriptomics data to identify post-transcriptional regulation

    • Compare with known protein-protein interaction networks

This approach provides a robust framework for interpreting complex proteomics data in the context of L438 function.

What are the key considerations when comparing viral fitness data between wild-type and L438-modified mimivirus?

When analyzing viral fitness data, researchers should consider:

  • Growth Kinetics Assessment:

    • Monitor viral factory formation using immunofluorescence at multiple time points

    • Quantify delay in eclipse phase as a key indicator of replication efficiency

    • Track cytopathic effects through microscopic observation

    • Use growth curves to visualize replication dynamics

  • Viral Production Quantification:

    • Employ qPCR for precise measurement of viral genome copies

    • Use flow cytometry to quantify viral particle production

    • Apply electron microscopy to confirm viral morphology

    • Calculate viral titers using plaque assays or end-point dilution methods

  • Statistical Analysis Framework:

    ParameterMeasurement MethodStatistical Approach
    Eclipse phase timingImmunofluorescenceTime-to-event analysis
    Replication rateqPCR at intervalsRegression analysis
    Final viral yieldFlow cytometryt-test or ANOVA
    Morphological integrityElectron microscopyDescriptive statistics
  • Interpretation Guidelines:

    • Distinguish between effects on replication rate versus final yield

    • Consider potential compensatory mechanisms that may mask phenotypes

    • Evaluate reproducibility across multiple independent experiments

    • Assess whether observed differences are biologically significant

These considerations ensure robust analysis and meaningful interpretation of viral fitness data when studying L438 function.

How can researchers effectively visualize and analyze the tertiary structure of L438 to inform functional studies?

To effectively analyze the tertiary structure of L438:

This integrated approach combines computational predictions with experimental validation to gain structural insights that can guide functional studies of L438.

What are the most promising research avenues for understanding L438's role in mimivirus pathogenesis?

Based on current knowledge gaps and experimental capabilities, the following research directions hold particular promise:

  • Comprehensive Functional Characterization:

    • Develop an L438 knockout system using CRISPR-Cas9 or similar technology

    • Perform complementation studies with mutant versions of L438

    • Investigate L438's role across different mimivirus strains

    • Explore potential host factors that interact with L438

  • Structural Biology Approaches:

    • Determine the crystal structure of L438 alone and in complex with DNA

    • Perform hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Utilize cryo-electron microscopy to visualize L438 in the context of the viral particle

    • Characterize the TLC domain's specific function through targeted mutagenesis

  • Systems Biology Integration:

    • Map the L438 interactome using proximity-dependent biotin identification

    • Perform temporal proteomics to track L438 dynamics during infection

    • Develop computational models of L438's role in the viral replication network

    • Compare L438 function across related giant viruses

This multifaceted approach would significantly advance our understanding of L438's role in mimivirus biology and potentially reveal new antiviral strategies.

How might comparative studies across different giant viruses enhance our understanding of L438 function?

Comparative studies offer valuable insights into evolutionary conservation and functional significance:

  • Evolutionary Analysis Framework:

    • Identify L438 homologs across the Mimiviridae family and other giant viruses

    • Construct phylogenetic trees to trace evolutionary relationships

    • Analyze selection pressures on different protein domains

    • Identify co-evolving protein partners across viral species

  • Functional Conservation Assessment:

    Virus FamilyL438 Homolog StatusFunctional ConservationExperimental Approach
    MimiviridaeDirect homologsLikely high conservationCross-complementation studies
    MarseilleviridaeDistant homologsPotential functional divergenceDomain swapping experiments
    PandoraviridaeNo clear homologsIndependent solutionsComparative proteomics
  • Host-Range Implications:

    • Correlate L438 sequence variations with host specificity

    • Test L438 variants in cross-species infection experiments

    • Identify host factors that interact differentially with L438 variants

    • Assess L438's role in determining viral tropism

  • Structural Adaptations:

    • Compare predicted structures of L438 homologs across viral species

    • Identify conserved structural features despite sequence divergence

    • Map adaptive mutations to structural regions

    • Correlate structural differences with functional specializations

These comparative approaches would place L438 in an evolutionary context and potentially reveal fundamental principles of giant virus biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.