Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized glycosyltransferase L373 (MIMI_L373)

Shipped with Ice Packs
In Stock

Description

Introduction

Acanthamoeba polyphaga Mimivirus (APMV) is a giant virus known to infect amoebae . Its large DNA genome encodes for nearly 1,000 proteins, including glycosyltransferases . Glycosyltransferases are enzymes that catalyze the formation of glycosidic bonds, utilizing sugar donors containing a nucleoside phosphate or a lipid phosphate leaving group . The Mimivirus utilizes its own glycosylation machinery, which includes several nucleotide sugar synthesizing and modifying enzymes, as well as glycosyltransferases, which share structural similarity with prokaryotic and eukaryotic glycosyltransferases . Understanding the glycosylation machinery of Mimivirus can help clarify the role of glycosylation in giant virus infection and replication .

Recombinant Production

Recombinant MIMI_L373 can be produced in E. coli with an N-terminal His tag .

Glycosyltransferase Function and Mechanism

Glycosyltransferases control the diversity of glycan structures because most catalyze the formation of unique glycosidic bonds . Structural and kinetic studies of glycosyltransferases have provided new insights into their function . Inverting glycosyltransferases use a direct displacement S$$_N$$2-like mechanism involving an enzymatic base catalyst . Retaining glycosyltransferases likely proceed through a mechanism involving a short-lived oxocarbenium ion intermediate, with the leaving phosphate serving as the base .

Tables

Cat.No. :RFL36286AF
Product Overview :Recombinant Full Length Acanthamoeba polyphaga mimivirus Uncharacterized glycosyltransferase L373(MIMI_L373) Protein (Q5UQW4) (1-251aa), fused to N-terminal His tag, was expressed in E. coli .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L373; Uncharacterized glycosyltransferase L373
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L373
Target Protein Sequence
MIPNIIHQIWIQGYESIPSELRKYHENCLKINYGFKNEFWDNDRIRNFLKNNFEPEYLEL YDKYKIYAQKADFARYAILKIHGGIYLDMDMVCRKNLGDFLGLGFFFTAYKLKNVFTNYL NGVIGSRPNHPVFDYIFKNMFLRQNDASNVTNSTGTKLFRDSITEYTKNNPTNDISLIDS KYLHPCNLYNDKNCPYTCTDCYIAHTNYSSWAPHLKLCKIFFENKYLIFIIIIIIFIILI LLWIKYKFNKS
Uniprot No.

Target Background

Database Links

KEGG: vg:9924993

Protein Families
Glycosyltransferase 32 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is MIMI_L373 and what is its role in mimivirus biology?

MIMI_L373 is an uncharacterized glycosyltransferase encoded by the Acanthamoeba polyphaga mimivirus genome. Research has identified it as a specific UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics . This enzyme is part of mimivirus's extensive glycosylation machinery, which includes several nucleotide sugar synthesizing and modifying enzymes. The mimivirus genome contains eleven genes that share structural similarity with prokaryotic and eukaryotic glycosyltransferases, with L373 being one of them . Understanding L373's function contributes to our knowledge of mimivirus's host-independent glycosylation system, which appears to be essential for viral infection and replication.

How was L373 initially identified and characterized?

L373 was initially identified through genomic analysis of the Acanthamoeba polyphaga mimivirus. After discovery, researchers cloned and expressed the protein in Spodoptera frugiperda Sf9 cells as a FLAG-fusion protein for functional characterization . Biochemical analysis revealed that L373 functions as a UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics. Its activity was found to be dependent on divalent metal ions, a common feature of many glycosyltransferases . This characterization was part of a broader effort to understand mimivirus's unusual capacity for self-glycosylation, which is typically a host-dependent process for most viruses.

What expression systems have been successfully used for recombinant MIMI_L373 production?

Based on available research data, MIMI_L373 has been successfully expressed in insect cells, specifically Spodoptera frugiperda Sf9 cells, as a FLAG-fusion protein . Unlike some other mimivirus glycosyltransferases (such as L193, R139, R363, R654, and R707) that were successfully expressed in E. coli as His-fusion proteins, L373 required the eukaryotic expression system provided by Sf9 cells . This suggests that L373 may have specific folding requirements or post-translational modifications necessary for proper expression that are not adequately provided by prokaryotic expression systems.

How does the catalytic mechanism of L373 compare to other viral and eukaryotic glycosyltransferases?

L373 functions as a UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics, suggesting a novel enzymatic mechanism . Unlike traditional glycosyltransferases that primarily transfer sugar moieties to acceptor substrates, L373 appears to preferentially hydrolyze the UDP-N-acetylglucosamine donor. This dual functionality places L373 in a unique mechanistic category.

When comparing L373 to other glycosyltransferases, it's important to note the unique features of mimivirus glycosyltransferases like R707, which has been shown to form both α1,6 or β1,6 linkages as well as α1,4 linkages—a dual-configuration ability not previously described in glycosyltransferases . The metal ion dependency of L373 is consistent with many GT-A fold glycosyltransferases that utilize a metal-dependent SN2-like displacement mechanism.

While specific structural data for L373 is limited, sequence analysis suggests it may share distant homology with other glycosyltransferases while having evolved distinct catalytic properties adapted to viral glycan synthesis.

What is the evolutionary relationship between MIMI_L373 and other viral or host glycosyltransferases?

Evolutionary analysis suggests that mimivirus glycosyltransferases, including L373, may have been acquired through horizontal gene transfer from eukaryotic hosts or bacteria. Comparative genomic analyses have identified 52 putative mimiviral proteins with homology to human proteins, with collagen-modifying enzymes and related proteins forming the largest functional network .

While not specifically addressing L373, research on other mimivirus proteins like R135 shows that some mimivirus glycosyltransferases have homologs only within the three lineages of mimivirus (A, B, and C), suggesting they were present in the common ancestor of these lineages . Similarly, structure prediction tools have been used to identify potential functional homology between mimivirus proteins and human counterparts, although often with modest confidence scores due to evolutionary distance .

For L373 specifically, its specialized function as a UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics suggests a unique evolutionary trajectory, potentially representing an adaptation that supports the virus's unusual capacity for host-independent glycosylation.

What structural domains and active site residues are critical for L373 function?

While detailed structural information specifically for L373 is not fully characterized in the available research, we can infer some features based on its biochemical properties. As a UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics, L373 likely contains:

  • A nucleotide-binding domain that recognizes and binds UDP-N-acetylglucosamine

  • Metal-binding residues that coordinate the divalent metal ion essential for its activity

  • Catalytic residues responsible for the hydrolysis of the glycosidic bond

By analogy with other glycosyltransferases, key catalytic residues might include aspartate or glutamate residues that coordinate the metal ion and participate in the catalytic mechanism. Structure prediction approaches similar to those used for other mimivirus proteins could provide additional insights into L373's folding and domain organization .

For definitive identification of critical residues, site-directed mutagenesis studies would be necessary to systematically evaluate the impact of specific amino acid substitutions on enzymatic activity.

What are the optimal conditions for expressing and purifying recombinant MIMI_L373?

Based on research findings, the optimal expression system for recombinant MIMI_L373 is the insect cell system using Spodoptera frugiperda Sf9 cells with a FLAG-fusion tag . The following protocol represents a recommended approach:

Expression Protocol:

  • Clone the L373 gene into an appropriate insect cell expression vector containing a FLAG-tag sequence

  • Generate recombinant baculovirus using standard protocols

  • Infect Sf9 cells at optimal density (typically 1-2 × 10^6 cells/mL)

  • Harvest cells 48-72 hours post-infection

Purification Protocol:

  • Lyse cells in buffer containing appropriate protease inhibitors

  • Clarify lysate by centrifugation (typically 10,000-20,000 × g for 30 minutes)

  • Purify using anti-FLAG affinity chromatography

  • Elute with FLAG peptide or low pH

  • Further purify via size exclusion chromatography if needed

Buffer Considerations:

  • Include divalent metal ions (Mg²⁺ or Mn²⁺) in storage buffers to maintain enzyme stability

  • Optimize pH based on enzyme stability (typically pH 7.0-8.0)

  • Consider including glycerol (10-20%) to improve protein stability

Other expression systems including E. coli have proven less successful for L373, despite their effectiveness for other mimivirus glycosyltransferases .

What in vitro assays can accurately measure L373 enzymatic activity?

For measuring L373's UDP-N-acetylglucosamine hydrolase activity with glycosyltransferase-like characteristics, the following assays can be employed:

1. UDP-Glo™ Glycosyltransferase Assay:

  • Principle: Measures released UDP as a product of glycosyltransferase reaction

  • Procedure: Incubate L373 with UDP-N-acetylglucosamine, then add UDP detection reagent

  • Readout: Luminescence signal proportional to UDP release

  • Advantages: High sensitivity, compatible with high-throughput screening

2. LC-MS/MS Analysis:

  • Principle: Direct detection of reaction products and substrates

  • Procedure: Incubate L373 with UDP-N-acetylglucosamine, quench reaction, analyze by LC-MS/MS

  • Readout: Quantification of substrate consumption and product formation

  • Advantages: Provides structural information about reaction products

3. Coupled Enzyme Assay:

  • Principle: Couples UDP release to NADH oxidation via pyruvate kinase and lactate dehydrogenase

  • Procedure: Incubate L373 with UDP-N-acetylglucosamine in presence of coupling enzymes

  • Readout: Decrease in absorbance at 340 nm

  • Advantages: Continuous monitoring of reaction progress

Assay Conditions:

  • Buffer: Typically Tris-HCl or HEPES (pH 7.0-8.0)

  • Metal ions: Include divalent metal ions (Mg²⁺ or Mn²⁺) at 1-10 mM

  • Temperature: 25-37°C

  • Substrate concentration: 0.1-1 mM UDP-N-acetylglucosamine

  • Enzyme concentration: 0.1-10 μg/mL, depending on activity

How can site-directed mutagenesis be used to identify critical residues in L373?

Site-directed mutagenesis represents a powerful approach to identifying functionally important residues in L373. A systematic strategy would include:

Selection of Target Residues:

  • Conserved residues identified through sequence alignment with other glycosyltransferases

  • Predicted metal-binding residues (typically Asp, Glu, His)

  • Predicted catalytic residues based on structural modeling

  • Residues in predicted substrate-binding pockets

Mutagenesis Strategy:

  • Conservative substitutions (e.g., Asp→Glu) to test specific chemical properties

  • Alanine scanning of putative active site regions

  • Introduction of non-conservative mutations to disrupt specific interactions

Experimental Pipeline:

  • Generate mutant constructs using standard molecular biology techniques

  • Express and purify mutant proteins using the established Sf9 expression system

  • Assess protein folding/stability using circular dichroism or thermal shift assays

  • Measure enzymatic activity using the UDP-Glo™ assay or other established methods

  • Determine kinetic parameters (kcat, KM) for active mutants

Data Analysis:

  • Compare activity levels of mutants as percentage of wild-type activity

  • Classify mutations as affecting substrate binding (altered KM) or catalysis (altered kcat)

  • Correlate findings with structural models to develop a mechanistic understanding

What are the key kinetic parameters for L373 and how do they compare to other glycosyltransferases?

Based on the characterization of L373 as a UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics, we can compare its kinetic parameters with those of other glycosyltransferases. While specific numerical values for L373 are not provided in the available research, the following table presents typical ranges for glycosyltransferases and hydrolases for comparison:

Enzyme TypeKM (μM)kcat (s⁻¹)kcat/KM (M⁻¹s⁻¹)Metal Dependence
Typical Glycosyltransferases10-5000.1-10010³-10⁶Often Mg²⁺ or Mn²⁺ dependent
Sugar Nucleotide Hydrolases50-10001-5010³-10⁵Variable
Mimivirus L373Metal-dependent activity with UDP-N-acetylglucosamine --Requires divalent metal ions
Mimivirus R707 (for comparison)Forms α1,6, β1,6, and α1,4 linkages --Divalent metal ion dependent

The metal ion dependency of L373 is consistent with many glycosyltransferases, particularly those with GT-A folds that coordinate a divalent metal ion, typically Mg²⁺ or Mn²⁺, to facilitate the departure of the nucleoside diphosphate leaving group. This mechanistic feature is shared with other mimivirus glycosyltransferases like R707 .

For comprehensive kinetic characterization, further studies would need to determine specific values for KM, kcat, and substrate specificity for L373 compared to well-characterized glycosyltransferases.

How does glycosylation by L373 affect mimivirus infection and replication?

While direct evidence linking L373-specific glycosylation to mimivirus infection is limited in the available research, several lines of evidence highlight the importance of glycosylation for mimivirus biology:

  • Glycan-Mediated Host Interaction: Co-infection studies with mimivirus and polysaccharides (amylose or dextran) showed a dose-dependent decrease in infection rates, demonstrating that glycan-glycan binding protein interactions are critical for mimivirus infection .

  • Viral Fiber Glycosylation: Mimivirus fibrils contain glycosylated proteins (including R135) that mediate adhesion to host cells. These fibrils are specifically modified with mannose and N-acetylglucosamine, facilitating attachment to amoebae and virophages .

  • Host-Independent Glycosylation: Mimivirus has evolved a complete glycosylation machinery, suggesting strong evolutionary pressure to maintain this capability independent of host glycosylation systems .

While L373 specifically functions as a UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics , its exact contribution to viral glycan structures remains to be fully elucidated. The enzyme's specificity for UDP-N-acetylglucosamine suggests potential involvement in generating or modifying N-acetylglucosamine-containing structures, which are known components of mimivirus fibrils involved in host attachment .

Further studies using gene silencing, CRISPR-based gene editing, or specific inhibitors would be needed to directly link L373 activity to specific aspects of the viral infection cycle.

What structural or functional similarities exist between L373 and human glycosyltransferases?

Comparative genomic analysis between mimivirus and human proteins has revealed numerous homologous genes, including those encoding collagens and collagen-modifying enzymes . While specific structural comparisons for L373 are not detailed in the available research, several general observations can be made:

  • Catalytic Mechanism: As a UDP-N-acetylglucosamine hydrolase with glycosyltransferase-like characteristics , L373 likely shares mechanistic features with human glycosyltransferases that utilize UDP-N-acetylglucosamine, such as certain O-GlcNAc transferases.

  • Metal Ion Dependency: L373's requirement for divalent metal ions parallels many human GT-A fold glycosyltransferases that utilize a metal ion to coordinate the UDP portion of the donor substrate.

  • Evolutionary Relationship: Genome-wide comparisons between mimivirus and human proteins have identified 52 putative mimiviral proteins with homology to human proteins . While L373 is not specifically mentioned in this list, the extensive homology between human and mimiviral proteins suggests potential evolutionary relationships.

  • Functional Network Context: Collagen and collagen-modifying enzymes form the largest subnetwork in the functional comparison between human and mimiviral proteins . This suggests that glycosyltransferases involved in collagen modification may share conserved features across diverse organisms, potentially including L373.

For precise structural comparisons, experimental determination of L373's three-dimensional structure would be necessary, followed by comparison with structures of human glycosyltransferases using tools such as DALI or VAST.

What are promising approaches for developing selective inhibitors of L373?

Developing selective inhibitors for L373 represents an opportunity to probe its biological function and potentially create antivirals targeting the mimivirus glycosylation machinery. Promising approaches include:

Structure-Based Drug Design:

  • Determine the crystal structure of L373 through X-ray crystallography or cryo-EM

  • Identify binding pockets suitable for small molecule binding

  • Use computational docking to screen virtual libraries for potential binders

  • Optimize lead compounds through medicinal chemistry

Substrate Analog Development:

  • Design and synthesize UDP-N-acetylglucosamine analogs with modifications to the sugar, nucleotide, or linkage

  • Test analogs for competitive inhibition of L373

  • Optimize potency and selectivity against human glycosyltransferases

High-Throughput Screening:

  • Adapt the UDP-Glo™ assay for high-throughput format

  • Screen diverse chemical libraries (natural products, fragment libraries)

  • Validate hits using orthogonal assays and counter-screens against human glycosyltransferases

Potential Scaffold Types:

  • Nucleotide analogs with modified sugar components

  • Bisubstrate inhibitors linking donor and acceptor mimics

  • Allosteric inhibitors targeting regulatory sites

The key challenge will be achieving selectivity against human glycosyltransferases while maintaining potency against L373. This will require detailed understanding of structural differences between L373 and its closest human homologs.

How might CRISPR-Cas9 gene editing be used to study L373 function in mimivirus infection?

CRISPR-Cas9 technology offers powerful approaches to study L373 function in the context of mimivirus infection. A comprehensive strategy would include:

Gene Knockout/Mutation Approaches:

  • Design guide RNAs targeting the L373 gene in the mimivirus genome

  • Deliver CRISPR-Cas9 components during viral replication

  • Screen for mutant viruses using PCR and sequencing

  • Characterize phenotypic effects on viral replication and host interaction

Technical Considerations:

  • Delivery method: Transfection of CRISPR-Cas9 components into host cells prior to infection

  • Selection strategy: Plaque assays to isolate individual viral clones

  • Validation: Sequencing to confirm mutations and Western blotting to verify protein absence

Phenotypic Analysis:

  • Growth curve analysis to assess replication efficiency

  • Electron microscopy to evaluate viral particle morphology

  • Glycan profiling to identify changes in viral glycosylation patterns

  • Host range studies to determine if L373 affects tropism

Complementation Experiments:

  • Express wild-type or mutant L373 in trans during infection with knockout virus

  • Determine which features of L373 are necessary for function

This approach would provide definitive evidence of L373's role in the viral life cycle and could identify novel aspects of mimivirus biology dependent on its glycosyltransferase activities.

What techniques can be used to characterize the complete glycome of mimiviruses and the specific contributions of L373?

Comprehensive characterization of the mimivirus glycome and L373's specific contributions requires an integrated approach combining multiple analytical techniques:

Mass Spectrometry-Based Glycomics:

  • N-glycan Analysis:

    • Release N-glycans using PNGase F or chemical methods

    • Permethylate released glycans to enhance ionization efficiency

    • Analyze by MALDI-TOF MS and/or LC-MS/MS

  • O-glycan Analysis:

    • Release O-glycans by beta-elimination

    • Analyze derivatized glycans by LC-MS/MS

    • Perform tandem MS to determine branching patterns

  • Glycopeptide Analysis:

    • Perform tryptic digestion of viral proteins

    • Enrich glycopeptides using lectin affinity or HILIC

    • Analyze by LC-MS/MS with ETD or EThcD fragmentation

Metabolic Labeling Approaches:

  • Incorporation of Labeled Sugars:

    • Culture host cells with azido- or alkyne-modified sugar precursors

    • Infect with mimivirus

    • Visualize incorporation using click chemistry and fluorescence microscopy

  • Pulse-Chase Experiments:

    • Pulse with labeled sugar during specific infection phases

    • Track incorporation into specific viral structures

Comparative Glycomics with L373 Mutants:

  • Generate L373 knockout or catalytically inactive mutants

  • Compare glycomic profiles of wild-type and mutant viruses

  • Identify specific glycan structures dependent on L373 activity

Lectin Microarray Analysis:

  • Print panels of diverse lectins on microarrays

  • Probe with fluorescently labeled wild-type and L373 mutant viruses

  • Identify differences in lectin binding profiles

The integration of these approaches would provide a comprehensive view of the mimivirus glycome and define the specific glycan structures modified by L373, linking molecular function to the broader context of viral glycobiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.