Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L310 (MIMI_L310)

Shipped with Ice Packs
In Stock

Description

Introduction

Acanthamoeba polyphaga mimivirus (APMV) is a giant virus that infects amoeba and possesses a large genome encoding numerous proteins with unknown functions . Among these is the Uncharacterized protein L310 (MIMI_L310). Investigating these uncharacterized proteins is crucial to understanding the virus's life cycle and interactions within its host .

General Information of Acanthamoeba polyphaga Mimivirus

Acanthamoeba polyphaga mimivirus (APMV) is the largest known virus regarding particle size and genome complexity . Discovered in 2003, APMV has a DNA genome encoding nearly 1,000 proteins . The size and complexity of Mimivirus sparked interest in the scientific community, leading to investigations into its structure, function, and interactions with its host .

Genomic Context and Characteristics

The Mimivirus genome, a 1.2-Mb DNA structure, encodes 911 proteins, but only a fraction have known functions . The viral particle incorporates proteins linked to transcriptional machinery, DNA repair, and oxidative pathways . A significant portion of these proteins have no known function .

Uncharacterized Protein L310 (MIMI_L310)

MIMI_L310 is one of the many uncharacterized proteins encoded by the Mimivirus genome . Proteins like MIMI_L310, while lacking characterized functions, are likely to participate in essential processes within the virus .

Importance of Studying Uncharacterized Proteins

Identifying the roles of uncharacterized proteins like MIMI_L310 is vital for a comprehensive understanding of Mimivirus biology . Functional analysis of these proteins may reveal novel mechanisms and potential targets for antiviral strategies .

Protein structure

The primary structure of a protein refers to the sequence of amino acids that make up the polypeptide chain1 . This sequence determines the protein's identity and characteristics . Peptide bonds link amino acids, creating a backbone with a specific order that dictates the protein's three-dimensional conformation and, therefore, its function .

The secondary structure describes the local folding patterns within the polypeptide chain, such as alpha helices and beta-pleated sheets1 . Hydrogen bonds stabilize these structures between the carbonyl and amino groups of the peptide backbone1.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L310; Uncharacterized protein L310
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L310
Target Protein Sequence
MDITKHLKPNLVDPNIEESIIKKLKPPVEDYWAPTKSGLHKFYHNFIRPNIYLIIFIIIV LLLLYYRYRRVKADKEKEKLEDTDKEFDKSTNNDTNSKKIYHRQKNSKTLNSSKKQSIDD TELLLQLYNLNKENLREPPITKSNFAYPMYPYHKGGTLISPGSR
Uniprot No.

Target Background

Database Links

KEGG: vg:9924927

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is MIMI_L310 and why is it significant for research?

MIMI_L310 is an uncharacterized protein encoded by the Acanthamoeba polyphaga mimivirus genome. Its significance stems from being part of the mimivirus proteome, one of the largest known viruses with complex structural and functional characteristics. While its specific function remains unknown, studying MIMI_L310 contributes to understanding the broader biology of mimiviruses and their interactions with host organisms. Similar uncharacterized mimivirus proteins have been found to play crucial roles in viral replication and infection processes, as evidenced by studies of other mimivirus proteins like L442, L724, and L829, which are associated with DNA-protein interactions necessary for viral production .

Methodological approach: Researchers should approach MIMI_L310 study through comparative genomics, protein-protein interaction assays, and functional screens to determine its role in viral biology. Initial steps include sequence analysis using bioinformatics tools to identify conserved domains and predict potential functions.

How does MIMI_L310 compare structurally with other mimivirus uncharacterized proteins?

While specific structural data for MIMI_L310 is currently limited in the literature, researchers can apply tertiary structure prediction tools such as Phyre2 (as was done for other mimivirus uncharacterized proteins like L442, L724, L829, and R387) . Structural comparisons with other mimivirus proteins may reveal functional relationships and evolutionary connections.

From related studies, we know that several mimivirus uncharacterized proteins have been found to associate with viral DNA and play roles in viral replication. For instance, L442 was identified as a key protein in DNA-mediated mimivirus generation, possibly functioning in DNA packaging or protection .

Methodological approach: Use a combination of bioinformatics prediction tools, circular dichroism, and, where possible, X-ray crystallography or cryo-EM to determine structural characteristics. Comparative analysis with other mimivirus proteins, particularly those with known functions, can provide insights into MIMI_L310's potential role.

What are the optimal expression and purification strategies for recombinant MIMI_L310?

Based on general full-length protein expression challenges and available information about mimivirus proteins, researchers should consider the following strategies:

Expression systems optimization:

Expression SystemAdvantagesPotential Challenges for MIMI_L310
E. coli (currently used)Fast growth, high yield, low costPotential issues with protein folding, possible toxicity
Insect cellsBetter post-translational modificationsHigher cost, longer production time
Mammalian cellsMost accurate post-translational modificationsHighest cost, complex protocols

Purification considerations:

  • The current His-tagged version facilitates IMAC (immobilized metal affinity chromatography) purification

  • Consider fusion tags on both N and C termini to ensure full-length protein isolation and distinguish from truncation products

  • Optimize imidazole concentration during elution to maximize purity

  • Follow with size exclusion chromatography to ensure homogeneity

Methodological approach: Begin with small-scale expression trials in E. coli, varying induction conditions (temperature, IPTG concentration, and induction time). Assess protein solubility in different buffers, and if issues arise, consider alternative expression systems. For purification, implement a multi-step approach starting with affinity chromatography followed by polishing steps like ion exchange or size exclusion.

How can researchers effectively investigate protein-protein interactions involving MIMI_L310?

To systematically study protein-protein interactions involving MIMI_L310:

  • Pull-down assays: Use recombinant His-tagged MIMI_L310 as bait to identify interacting proteins from Acanthamoeba polyphaga lysates, particularly during mimivirus infection.

  • Yeast two-hybrid screening: Employ this technique to identify potential binding partners from mimivirus or host proteomes.

  • Cross-linking mass spectrometry (XL-MS): This advanced technique can identify transient interactions and approximate binding interfaces.

  • Biolayer interferometry or surface plasmon resonance: These methods provide quantitative binding kinetics for identified interactions.

Given the findings with other mimivirus proteins, it's particularly important to investigate MIMI_L310's potential interactions with:

  • Viral DNA (using EMSA or ChIP-seq approaches)

  • Other structural viral proteins

  • Host proteins involved in infection pathways

Methodological approach: Begin with computational prediction of potential interaction partners based on homology to known mimivirus protein interaction networks. Follow with in vitro verification using pull-down assays and then progress to more sophisticated techniques for confirmed interactions. All experiments should include appropriate controls, including unrelated proteins of similar size and biochemical properties.

What techniques are most suitable for determining the function of uncharacterized MIMI_L310?

Determining the function of uncharacterized viral proteins requires a multifaceted approach:

  • Sequence-based prediction: Use bioinformatics tools to identify conserved domains, motifs, and potential functional sites.

  • Structural analysis: As demonstrated with other mimivirus proteins, structural prediction using tools like Phyre2 can provide functional insights. Consider X-ray crystallography or cryo-EM for high-resolution structural determination .

  • Localization studies: Track MIMI_L310 during the viral infection cycle using fluorescently tagged versions or immunofluorescence to identify its subcellular localization.

  • Gene silencing/knockout studies: Similar to studies performed with the R458 gene in mimivirus, silencing techniques can reveal downstream effects of MIMI_L310 absence .

  • Proteomics approach: Identify changes in the host or viral proteome when MIMI_L310 is overexpressed or depleted.

Methodological approach: Begin with computational predictions to generate hypotheses, then design wet-lab experiments to test these hypotheses systematically. Consider a transfection-based system similar to that used for studying other mimivirus proteins, where viral DNA with or without associated proteins can be introduced into host cells to study infectivity .

How can researchers determine if MIMI_L310 associates with mimivirus DNA during infection?

Based on findings with other mimivirus proteins that associate with viral DNA (such as L442, L724, L829, and R387), researchers should consider:

  • Chromatin immunoprecipitation (ChIP): Using antibodies against MIMI_L310 to pull down associated DNA, followed by sequencing to identify binding regions.

  • DNA-protein co-purification analysis: Similar to the methods described in the study of DNA-associated proteins necessary for mimivirus generation, extract viral DNA and analyze associated proteins using SDS-PAGE followed by mass spectrometry .

  • Electrophoretic mobility shift assay (EMSA): To detect direct binding between purified MIMI_L310 and viral DNA fragments.

  • DNA transfection experiments: Following the methodology used for other mimivirus proteins, compare transfection efficiency of viral DNA with or without associated proteins like MIMI_L310 .

Methodological approach: Begin with co-purification experiments to determine if MIMI_L310 naturally associates with viral DNA. If association is detected, proceed to more specific techniques like ChIP or EMSA to characterize the binding. Include controls with known DNA-binding and non-DNA-binding proteins to validate results.

What control experiments should be included when studying MIMI_L310 function in viral replication?

When designing experiments to study MIMI_L310's potential role in viral replication, include these essential controls:

  • Positive controls:

    • Known functional mimivirus proteins (e.g., R135 oxidoreductase)

    • Other DNA-associated proteins (e.g., L442, if studying DNA association)

  • Negative controls:

    • Unrelated viral proteins of similar size/structure

    • Denatured or mutated MIMI_L310 to confirm specificity

  • Treatment controls:

    • Proteinase K treatment (as used in mimivirus DNA transfection studies)

    • RNase treatment to distinguish RNA-mediated effects

    • DNase treatment to confirm DNA-dependent functions

  • Mock infections/transfections: To establish baseline cellular responses

  • Time-course analysis: Sampling at multiple time points to capture the dynamic nature of viral infection

Methodological approach: Design a matrix of experimental conditions that systematically tests each variable while controlling for others. Use statistical power calculations to determine appropriate sample sizes and replication numbers.

How can researchers address potential artifacts in MIMI_L310 functional studies?

Several sources of artifacts can confound studies of uncharacterized proteins like MIMI_L310:

  • Tag interference: The His-tag on recombinant MIMI_L310 may affect function or interactions

    • Solution: Compare N-terminal and C-terminal tags, or use cleavable tags

    • Validate key findings with untagged protein where possible

  • Expression system artifacts: Bacterial expression may result in improper folding

    • Solution: Compare proteins expressed in different systems (bacterial, insect, mammalian)

    • Verify structural integrity using circular dichroism or thermal shift assays

  • Binding artifacts in interaction studies:

    • Solution: Use multiple complementary techniques (pull-down, Y2H, BLI)

    • Include detergent controls to minimize non-specific hydrophobic interactions

  • Cell culture variables in infection studies:

    • Solution: Standardize amoeba culture conditions (as described for A. castellanii studies)

    • Control for amoeba passage number and physiological state

Methodological approach: For each experiment, include controls that specifically address potential artifacts. Validate findings using orthogonal methods, and thoroughly document experimental conditions to ensure reproducibility.

How should researchers interpret contradictory results when studying MIMI_L310?

When faced with contradictory results in MIMI_L310 studies:

  • Systematically review experimental variables:

    • Different expression systems may yield proteins with different activities

    • Buffer conditions can significantly affect protein behavior

    • Host cell state (e.g., A. castellanii growth phase) can influence infection dynamics

  • Consider protein context dependencies:

    • Some mimivirus proteins function differently in isolation versus in viral context

    • Protein complexes may be required for certain functions

    • Post-translational modifications may vary between systems

  • Evaluate detection method limitations:

    • Antibody specificity issues

    • Detection threshold differences between methods

    • Temporal dynamics that might be missed in endpoint assays

Methodological approach: When contradictory results arise, first verify technical reproducibility. Then systematically vary experimental conditions to identify which factors influence the outcome. Finally, consider whether the contradiction reflects genuine biological complexity rather than technical artifacts. Document all findings, including contradictory ones, as they may provide insights into regulatory mechanisms.

What are the most common challenges in expressing and purifying MIMI_L310, and how can they be addressed?

Based on general challenges with full-length proteins and information about mimivirus proteins, researchers should anticipate:

ChallengePotential CauseSolution Strategies
Low expression yieldCodon bias, protein toxicityCodon optimization, use of specialized host strains (e.g., Rosetta for rare codons), inducible systems with tight regulation
Protein insolubilityImproper folding, hydrophobic regionsLower induction temperature (16-20°C), solubility-enhancing fusion tags (SUMO, MBP), co-expression with chaperones
Proteolytic degradationInherent instability, host proteasesAdd protease inhibitors, use protease-deficient strains, optimize purification speed
Truncated productsInternal translation initiation, premature terminationDual affinity tags (N- and C-terminal), optimize Shine-Dalgarno sequences, increase imidazole during elution
Contaminating nucleic acidsDNA/RNA bindingInclude nuclease treatment, high-salt washes, additional purification steps

Methodological approach: Begin with small-scale expression trials to identify optimal conditions before scaling up. When problems arise, implement a systematic troubleshooting approach, changing one variable at a time. Document all conditions and results to build an optimization framework for future studies.

What emerging technologies could advance understanding of MIMI_L310 function?

Several cutting-edge technologies hold promise for elucidating MIMI_L310 function:

  • AlphaFold2 and other AI-based structure prediction: These tools can provide highly accurate structural predictions that may reveal functional domains and interaction surfaces .

  • CRISPR-based approaches: While challenging in viral systems, CRISPR technologies could enable precise genetic manipulation to study MIMI_L310 in context.

  • Cryo-electron tomography: This technique could visualize MIMI_L310 in situ within the viral particle or during infection.

  • Single-molecule techniques: Methods like FRET or optical tweezers could reveal dynamic aspects of MIMI_L310 function and interactions.

  • Microinjection combined with live-cell imaging: Building on established microinjection techniques for mimivirus DNA, researchers could track fluorescently labeled MIMI_L310 during infection .

Methodological approach: Stay abreast of technological developments in structural biology and single-cell analysis. Consider forming collaborations with specialists in emerging technologies to apply these methods to MIMI_L310 research. Pilot studies with well-characterized proteins can help establish protocols before applying them to MIMI_L310.

How might understanding MIMI_L310 contribute to broader virology research?

Understanding MIMI_L310 could impact several areas of virology:

  • Giant virus evolution: Characterizing MIMI_L310 function may provide insights into the evolutionary origins of giant viruses and their relationship to cellular organisms.

  • Viral replication mechanisms: If MIMI_L310 is involved in DNA replication or packaging, it could reveal novel mechanisms specific to large DNA viruses.

  • Host-virus interactions: MIMI_L310 may participate in subverting host defenses or reprogramming host metabolism.

  • Viral protein engineering: Insights from MIMI_L310 structure-function relationships could inform the design of novel protein tools or therapeutics.

  • Comparative virology: Functional characterization would enable comparisons with proteins from other virus families, potentially revealing convergent evolution or unique adaptations.

Methodological approach: Design studies that explicitly connect MIMI_L310 research to broader questions in virology. Consider comparative approaches that examine homologous proteins across different giant virus species. Collaborate with evolutionary biologists and structural biologists to place findings in broader context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.