Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L323 (MIMI_L323)

Shipped with Ice Packs
In Stock

Description

Introduction

Acanthamoeba polyphaga Mimivirus (APMV) is a giant virus known for its large particle size and complex genome . Discovered in 2003, APMV infects Acanthamoeba species and has a genome of 1.2 Mb that encodes 911 proteins . A significant portion of these proteins have unknown functions, including the Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L323 (MIMI_L323) . These uncharacterized proteins, including MIMI_L323, are presumed to participate in integrated processes within the virus .

General Information

MIMI_L323 is one of many uncharacterized proteins encoded by the Mimivirus genome . Proteomic analyses of Mimivirus virions have identified numerous proteins with unknown functions, suggesting that these proteins may play critical roles in the viral life cycle . Research indicates that during Mimivirus infection, the host amoeba detects and responds early, leading to cell cycle arrest .

Protein Structure

Proteins are composed of amino acids linked together in a specific sequence, which is known as the primary structure . This sequence is determined by the gene encoding the protein . The unique three-dimensional structure of a polypeptide is its tertiary structure . Interactions among R groups create the complex three-dimensional tertiary structure of a protein .

Research Findings

Research has focused on understanding the roles of uncharacterized proteins in Mimivirus. Studies have shown that several uncharacterized proteins are essential for the generation of infectious Mimivirus virions .

Role in Mimivirus Infection

The involvement of these proteins and RNA has been suggested to be associated with the early stages of infection but has never been fully investigated . During Mimivirus infection, the host cell undergoes significant changes, including cell cycle arrest and alterations in cytoskeleton homeostasis . These changes are accompanied by the modulation of various host genes and cellular components, such as the ubiquitin-proteasome system and peroxisomes .

Techniques Used in Research

To study Mimivirus and its proteins, researchers employ various techniques:

  • Microinjection: Mimivirus DNA is directly transfected into Acanthamoeba castellanii to generate infectious APMV virions .

  • Transcriptome Analysis: The transcriptome of Acanthamoeba polyphaga is analyzed during Mimivirus infection to understand the dynamics of both host and virus transcriptomes .

  • Proteomics: Mass spectrometry is used to identify and characterize the proteins present in purified Mimivirus virions .

  • Cell Culture: Acanthamoeba castellanii is used as a cellular support in peptone–yeast extract–glucose (PYG) medium to culture and observe Mimivirus infection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L323; Uncharacterized protein L323
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L323
Target Protein Sequence
MGASASTNEQIIENRILNEAYNSCPSVGTANVTTLSGIKFEAPANCNPPSAFVIGQTATV DSNCLLTSLQKGAASAASKLSSQSKAGLGISVSTNISEVENSIANITNNTCAGLATNNVV DITDTVIKACQFRVVQNASSKVSCQINNTQNLISKIAADATSQAKGGSLFGDLFGGGLGG IIAAIIIIVIIAVIIGAVVYFIKQSSKNKGAEKIIENPETAALLVGGFKSFIGGASDFVD GLKKTNMYKFIVLLIMVLIIVILLKTLDIPNPINHPNDSNRIY
Uniprot No.

Target Background

Database Links

KEGG: vg:9924940

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should recombinant MIMI_L323 be stored and handled for experimental use?

For optimal stability and experimental reproducibility, MIMI_L323 should be handled according to the following protocol:

Storage ConditionRecommendation
Long-term storageStore at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles
Working solutionStore at 4°C for up to one week
ReconstitutionReconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
Glycerol additionAdd 5-50% glycerol (optimal 50%) for long-term storage

Before opening vials, briefly centrifuge to bring contents to the bottom. Repeated freeze-thaw cycles should be strictly avoided as they may lead to protein denaturation and aggregation .

What expression systems are optimal for producing recombinant MIMI_L323?

While specific optimization data for MIMI_L323 is limited, based on experimental approaches used for similar viral proteins, the following expression parameters are recommended:

ParameterRecommended ConditionsNotes
Expression systemE. coli BL21(DE3)Initial screening system of choice
Induction temperature18-25°CLower temperatures improve folding of viral proteins
Induction concentration0.5 mM IPTGOptimize based on initial expression tests
Expression time16-18 hoursLonger expression at lower temperatures often yields better results
Media compositionLB or TB mediaTB provides higher cell density for increased yield

For researchers facing solubility issues, alternative approaches include:

  • Fusion with solubility-enhancing tags like MBP or SUMO

  • Testing E. coli strains optimized for rare codons (e.g., Rosetta)

  • Expression in eukaryotic systems for proteins requiring post-translational modifications

How can I design experiments to determine if MIMI_L323 interacts with host proteins?

A multi-faceted experimental design approach is recommended:

  • In silico prediction:

    • Analyze protein sequence for potential interaction motifs

    • Use structural prediction tools to identify potential binding surfaces

  • Pull-down assays:

    • Immobilize His-tagged MIMI_L323 on Ni-NTA resin

    • Incubate with host cell lysates (Acanthamoeba castellanii)

    • Wash stringently to remove non-specific binding

    • Identify binding partners using mass spectrometry

  • Co-immunoprecipitation:

    • Generate specific antibodies against MIMI_L323

    • Perform IP from infected cells at different time points

    • Analyze by Western blot and MS to identify interaction partners

  • Fluorescence microscopy methods:

    • Create fusion proteins with EGFP similar to the approach used for gp275

    • Perform co-localization studies in infected amoeba cells

    • Track protein dynamics during infection cycle

When designing these experiments, it's crucial to include appropriate controls, such as unrelated His-tagged proteins or uninfected cell lysates, to distinguish specific from non-specific interactions.

How can I conduct knockout studies to determine the essentiality of MIMI_L323?

Based on approaches used for other mimivirus proteins such as gp275 (R252 gene), a homologous recombination strategy can be employed :

  • Design a knockout construct containing:

    • 500-1000bp homology arms flanking the L323 gene

    • A selection marker (such as a fluorescent protein gene)

    • Optional: inducible promoter system if the gene is suspected to be essential

  • Experimental procedure:

    • Transfect the knockout construct into A. castellanii cells

    • Infect with wild-type mimivirus

    • Screen for recombinant viruses expressing the selection marker

    • Verify knockout by PCR and sequencing

  • Phenotypic analysis:

    • Compare replication kinetics between wild-type and knockout viruses

    • Assess viral factory formation using DAPI staining

    • Examine virion morphology by electron microscopy

    • Perform complementation studies to confirm specificity

If L323 is essential (like gp275 appears to be ), you may not recover viable knockout viruses, necessitating conditional knockout approaches or partial deletions.

What computational approaches can predict the structure and function of MIMI_L323?

Given the uncharacterized nature of MIMI_L323, computational approaches offer valuable initial insights:

Computational MethodApplicationExpected Output
Sequence homology (BLAST, HHpred)Identify distant homologsPotential functional classification
AlphaFold2/RoseTTAFold3D structure predictionFull atomic model with confidence scores
InterProScanDomain predictionIdentification of functional domains
Molecular dynamics simulationDynamic behaviorConformational flexibility insights
Protein-protein dockingInteraction predictionPotential binding interfaces
Electrostatic surface analysisFunction predictionIdentification of charged patches for nucleic acid binding

Recent advances in AI-based structure prediction have dramatically improved our ability to model proteins with no known homologs, making these approaches particularly valuable for uncharacterized proteins like MIMI_L323.

How can I investigate the localization and dynamics of MIMI_L323 during mimivirus infection?

Based on successful approaches with other mimivirus proteins , a fluorescent tagging strategy can be employed:

  • Create fluorescently tagged MIMI_L323:

    • Design a homologous recombination construct for in-frame fusion of EGFP to L323

    • Follow the approach used for tagging gp275 with EGFP

    • Consider dual labeling with another viral protein (such as capsid protein) tagged with RFP

  • Infection time-course imaging:

    • Infect A. castellanii cells with the recombinant virus

    • Perform live-cell imaging at different time points post-infection

    • Use DAPI staining to visualize viral factories and host nuclei

  • Analysis parameters:

    • Track protein localization throughout the infection cycle

    • Measure co-localization with viral DNA and other viral proteins

    • Quantify protein expression levels at different infection stages

  • Complementary approaches:

    • Immunogold electron microscopy for high-resolution localization

    • Biochemical fractionation to confirm subcellular localization

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

This approach would provide insights into whether MIMI_L323 is present in the virion or viral factory, and its potential role during different stages of the viral replication cycle.

What quality control measures should be implemented when working with recombinant MIMI_L323?

A comprehensive quality control workflow ensures experimental reproducibility:

QC ParameterMethodAcceptance Criteria
PuritySDS-PAGE with densitometry>90% purity
IdentityWestern blot with anti-His antibodySingle band at expected molecular weight
Mass verificationMass spectrometryMatch to theoretical mass ±0.1%
HomogeneitySize exclusion chromatographySingle symmetrical peak
Structural integrityCircular dichroismStable secondary structure profile
Thermal stabilityDifferential scanning fluorimetryConsistent Tm between batches
Functional activitySpecific binding/activity assaysActivity within predetermined range

For MIMI_L323 specifically, given its uncharacterized nature, establishing a panel of biophysical parameters that can be measured reproducibly is crucial for ensuring batch-to-batch consistency .

What are common experimental challenges when working with mimivirus proteins and how can they be addressed?

Researchers often encounter several challenges when working with giant virus proteins like MIMI_L323:

  • Expression and solubility issues:

    • Challenge: Formation of inclusion bodies

    • Solution: Lower induction temperature (16-18°C), use solubility-enhancing fusion tags (MBP, SUMO), or consider eukaryotic expression systems

  • Protein stability problems:

    • Challenge: Aggregation or degradation during purification

    • Solution: Screen buffer conditions using thermal shift assays, add stabilizing agents (glycerol, arginine), maintain strict temperature control

  • Functional assay development:

    • Challenge: Lack of known function for uncharacterized proteins

    • Solution: Start with broad-spectrum assays (DNA/RNA binding, enzymatic activities), leverage structural predictions to guide experimental design

  • Mimivirus handling difficulties:

    • Challenge: Complex infection dynamics in amoeba hosts

    • Solution: Standardize infection protocols, use appropriate MOI (multiplicity of infection), monitor viral factory formation as infection marker

When facing these challenges, a systematic troubleshooting approach based on experiences with similar proteins in the field is recommended .

What experimental design approaches have been successful for other mimivirus proteins that could be applied to MIMI_L323?

Several successful experimental approaches used with other mimivirus proteins can be adapted:

  • Homologous recombination for protein tagging:

    • The approach used for EGFP-tagging gp275 and RFP-tagging capsid protein has proven successful

    • This same strategy can be applied to L323 for localization studies

  • Co-localization with viral factories:

    • DAPI staining of viral DNA combined with fluorescent protein localization has effectively tracked protein dynamics during infection

    • This approach can reveal if MIMI_L323 associates with viral factories like gp275

  • Mass spectrometry identification in virions:

    • Proteomic analysis of purified virions has successfully identified virion-associated proteins

    • This approach can confirm if MIMI_L323 is a structural component of mimivirus particles

  • Knockout experiments for essentiality testing:

    • Gene knockout approaches have demonstrated the essential nature of some mimivirus genes

    • Similar methods can determine if L323 is essential for viral replication

These proven methodologies provide a solid framework for investigating MIMI_L323 function while minimizing experimental risk.

What are promising research avenues for elucidating MIMI_L323 function in mimivirus biology?

Given the current knowledge gaps, several research directions offer promising insights:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM studies of purified MIMI_L323

    • Structural comparisons with proteins of known function

    • Identification of potential active sites or binding pockets

  • Host-pathogen interaction studies:

    • Identification of host proteins that interact with MIMI_L323

    • Investigation of how these interactions change during infection progression

    • Determination if MIMI_L323 affects host cellular processes

  • Evolutionary analysis:

    • Comprehensive comparison with related proteins in other giant viruses

    • Analysis of sequence conservation and selection pressure across viral lineages

    • Identification of conserved motifs that may indicate functional importance

  • Systems biology approaches:

    • Transcriptomic and proteomic profiling comparing wild-type and L323-mutant viruses

    • Network analysis to position MIMI_L323 in the context of viral replication

    • Machine learning approaches to predict functional partners based on expression patterns

These complementary approaches would provide a multi-dimensional view of MIMI_L323 function and its role in mimivirus biology.

How might studying MIMI_L323 contribute to our broader understanding of giant virus biology?

Investigating uncharacterized proteins like MIMI_L323 has several broader implications:

  • Understanding mimivirus genome complexity:

    • Giant viruses like mimivirus have many uncharacterized genes that distinguish them from smaller viruses

    • Characterizing these genes helps explain how giant viruses evolved such complexity

  • Insights into virus-host coevolution:

    • Many mimivirus proteins may be involved in counteracting host defense mechanisms

    • MIMI_L323 might play a role in host manipulation or immune evasion

  • Novel biological mechanisms:

    • Giant viruses often contain genes with novel functions not seen in other organisms

    • Studying MIMI_L323 may reveal previously unknown biological processes

  • Biotechnological applications:

    • Viral proteins often have unique properties suitable for biotechnology applications

    • Characterizing MIMI_L323 might reveal useful enzymatic activities or binding properties

By systematically investigating proteins like MIMI_L323, researchers contribute to filling significant knowledge gaps in viral molecular biology and evolution.

What are the best experimental design approaches to test hypotheses about MIMI_L323 function?

When designing experiments for an uncharacterized protein like MIMI_L323, a systematic approach is essential:

This methodical approach maximizes the chance of correctly identifying MIMI_L323 function while minimizing false leads .

How can researchers effectively analyze and interpret contradictory data when studying uncharacterized proteins like MIMI_L323?

When faced with contradictory experimental results, which is common when studying uncharacterized proteins, researchers should:

  • Systematic error analysis:

    • Examine experimental conditions for differences that might explain contradictions

    • Consider protein batch variations, buffer conditions, and experimental parameters

    • Implement standardized protocols with detailed documentation

  • Reconciliation strategies:

    • Consider if contradictory results might reflect different aspects of a multifunctional protein

    • Examine if results vary based on experimental context (in vitro vs. in vivo)

    • Develop integrative models that might explain seemingly contradictory observations

  • Advanced analytical approaches:

    • Use statistical methods appropriate for complex datasets

    • Consider Bayesian approaches to integrate prior knowledge with new data

    • Apply machine learning techniques to identify patterns across multiple experiments

  • Collaborative verification:

    • Engage with other laboratories to independently verify key findings

    • Share detailed protocols to ensure methodological consistency

    • Establish community standards for working with specific viral proteins

These strategies help distinguish genuine biological complexity from experimental artifacts when investigating novel proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.