Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L416 (MIMI_L416)
Description
Overview of MIMI_L416
MIMI_L416 is a 105-amino acid protein (11.8 kDa) expressed in Escherichia coli with an N-terminal His tag for purification . Its sequence is:
MYTSIYQNSYVVFIISLIVLLIIFYVFKIGYSTVVVNGKVEKRFNWKYPLAISLVIWVIWYFLLYPPSDVNINSSKQVGGTETSTIGDIVGSGVRQQKINMDNWL
Research Applications
Recombinant MIMI_L416 is primarily used as a reagent in virology and structural biology:
-
Antigen Production: Utilized in ELISA kits (e.g., CSB-CF713266ADAZ) for antibody generation or diagnostic assays .
-
Functional Studies: Potential involvement in Mimivirus replication pathways inferred from homologous proteins’ roles in DNA microinjection experiments .
-
Structural Analysis: Full-length expression enables crystallography or NMR studies to resolve its 3D architecture .
Technical Notes and Limitations
-
Stability: Lyophilized form retains activity for 12 months at -80°C, but repeated thawing reduces functionality .
-
Protein Interactions: Preliminary data suggest interactions with other Mimivirus proteins (e.g., R135 oxidoreductase) , though MIMI_L416-specific partners remain unidentified .
-
Functional Knowledge Gaps: No direct evidence links MIMI_L416 to viral replication, host interaction, or immune evasion.
Future Directions
Research priorities include:
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: vg:9925037
