Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L446 (MIMI_L446)

Shipped with Ice Packs
In Stock

Description

Introduction

Acanthamoeba polyphaga Mimivirus (APMV) is a giant virus that infects amoeba and has a large DNA genome encoding nearly 1,000 proteins . One of the most interesting findings regarding APMV is the presence of many proteins and RNAs within the virion, though the roles of these proteins are not fully understood . In a study directly transfecting mimivirus DNA into Acanthamoeba castellanii, it was found that at least four uncharacterized proteins, including L442, L724, L829, and R387, are needed for DNA-mediated APMV generation .

MIMI_L446 Overview

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L446 (MIMI_L446) is a hypothetical protein of the Acanthamoeba polyphaga Mimivirus. Research indicates that several uncharacterized proteins, including L446, are believed to be involved in the early stages of infection, although this has not been fully investigated .

Research Findings

  • Identification of Key Proteins: Through direct transfection of mimivirus DNA into Acanthamoeba castellanii, researchers identified several proteins, including L442, L724, L829, and R387, as essential for the generation of infectious APMV virions .

  • Role in Viral Infection: These proteins are thought to play a role in the early stages of infection .

  • Further Research: Future studies involving expression in vectors and X-ray diffraction of protein crystals could help reveal the exact structure of L442 and its precise function .

Tables

It is essential to present data clearly and concisely in tables, ensuring they are easily understood without reference to the main text . Tables should have clear titles and descriptive column heads .

Table 1: Proteins Involved in Mimivirus Virion Generation

ProteinFunction
L442Hypothetical protein
L724Hypothetical protein
L829Hypothetical protein
R387Hypothetical protein
R135Putative GMC-type oxidoreductase

Table 2: Experimental Conditions for Mimivirus Production

ParameterCondition
Host CellAcanthamoeba castellanii
Culture MediumPeptone-yeast extract-glucose (PYG)
Cell Concentration5 × 10^5 cells/ml
Incubation Temperature28°C
Multiplicity of Infection10

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L446; Uncharacterized protein L446
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L446
Target Protein Sequence
MNNSNTDNIIIINDSEPTYNLEDVINEIGDLLEDFDKIIDQYKQTIDQMVKKPKYVNLVL SGGSIRGISHIGVIKKLIDEELLDLSKMKAVAGVSAGAMLGLLIVLGFTIGEIWDFILNL DTKKIVDPDFMLILEKCGVERGRIIYDLIEDILTSKTDTKHINFKQLYEKTGIHFTVVGS CLTTKDVIYYDHINTPTFKVSVAVRISIGMPGFFTPIDIGGKKYIDGAVLNNYPMNLFAK ELDKTIGILICNEHNTNYKYFEEYFMAIINLFMYNYFEKTCHQYADNTIYVKKAPENVFI FNFDLDNNTKMKLFEYGIEAAEEFIKNKFDNK
Uniprot No.

Target Background

Function
Probable lipid hydrolase.
Database Links

KEGG: vg:9925070

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is recombinant MIMI_L446 typically produced and purified?

Production of recombinant MIMI_L446 is typically accomplished through heterologous expression in E. coli systems. The methodological approach includes:

  • Vector Construction: The full-length gene encoding MIMI_L446 (1-332 aa) is cloned into an expression vector with an N-terminal His-tag for purification purposes.

  • Expression Conditions: The protein is expressed in E. coli under optimized conditions, typically using BL21(DE3) or similar strains.

  • Purification Protocol:

    • Initial capture via Immobilized Metal Affinity Chromatography (IMAC) using the His-tag

    • Buffer conditions typically contain Tris-based buffer with 6% trehalose at pH 8.0

    • Elution with increasing imidazole concentration gradient

    • Further purification may involve size exclusion chromatography

  • Storage: The purified protein is typically stored in Tris/PBS-based buffer with 50% glycerol at pH 8.0, and preserved at -20°C/-80°C. For working stocks, aliquots can be maintained at 4°C for up to one week .

  • Reconstitution: The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage .

What are the key considerations for designing experiments using MIMI_L446 in viral-host interaction studies?

When designing experiments to study MIMI_L446's role in viral-host interactions, researchers should consider:

  • Host Selection: While mimivirus has been traditionally studied in Acanthamoeba hosts, research suggests potential interactions with other hosts. Consider testing:

    • Amoeba species (traditional laboratory hosts)

    • Mammalian cell lines (e.g., A549 lung adenocarcinoma cells which have shown interaction with mimivirus)

    • Lignin-containing algae (suggested by structural similarities of mimivirus R135 protein to lignin-degrading enzymes)

  • Variables Control:

    • Viral concentration (MOI) - using different multiplicities of infection (10-50 MOI recommended based on previous studies)

    • Incubation time (typical protocols use 6-hour initial exposure followed by 36-hour incubation)

    • Temperature (37°C for mammalian cells, adjusted for other host systems)

  • Experimental Controls:

    • Non-infected host cells

    • Host cells infected with other mimivirus strains

    • Host cells treated with specific inhibitors (e.g., polymyxin B as used in TLR4 studies)

  • Visualization and Quantification Methods:

    • Fluorescence labeling (rhodamine-phalloidin for viral particles, FITC-CTB for cell membranes)

    • Scanning electron microscopy for surface interactions

    • Confocal microscopy for co-localization studies

    • Immunoblotting for protein expression analysis

  • Biochemical Interaction Analysis:

    • Co-immunoprecipitation to identify protein-protein interactions

    • ELISA-based binding assays to quantify interaction strength

    • Functional assays to assess enzymatic activity changes

How can researchers effectively study the functional role of MIMI_L446 in the mimivirus replication cycle?

To elucidate the functional role of MIMI_L446 in the mimivirus replication cycle, consider these methodological approaches:

  • Gene Knockout/Knockdown Studies:

    • Generate recombinant mimivirus strains with MIMI_L446 deletion or disruption

    • Create conditional knockdown systems if the gene proves essential

    • PCR verification of disruption (similar to thymidylate synthase disruption methods)

  • Localization Studies:

    • Use fluorescently tagged versions of MIMI_L446 to track its localization during infection

    • Determine if it localizes to viral factories, specifically to outer layer (OL) or inner layer (IL)

    • Co-localization with known OL markers (like OLS1) or IL markers (like ILS1)

  • Temporal Expression Analysis:

    • Analyze expression timing using RT-qPCR and Western blot

    • Correlate with different stages of viral factory development

    • Determine if it's expressed early or late in the infection cycle using promoter analysis based on AAAATTGA motif presence/absence

  • Interaction Network Mapping:

    • Identify potential protein-protein interactions using pull-down assays

    • Confirm interactions using two-way co-immunoprecipitation

    • Map to known viral factory proteins and their compartments

  • Functional Complementation:

    • Express MIMI_L446 in trans to rescue knockout phenotypes

    • Use mutated versions to identify critical residues/domains

    • Test cross-complementation with related genes from other NCLDV members

The presence/absence of the conserved AAAATTGA promoter motif can provide clues about the timing of MIMI_L446 expression, as genes with this motif may be expressed earlier in the infection cycle .

What computational approaches are recommended for predicting the structure and function of MIMI_L446?

For computational analysis of MIMI_L446 structure and function, researchers should implement a multi-faceted approach:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with known lipid hydrolases

    • Motif identification using PROSITE, Pfam, and InterPro

    • Evolutionary analysis using MEGA3 software to establish phylogenetic relationships with homologs in Sargasso Sea metagenomic data and other NCLDVs

  • Structure Prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • I-TASSER for comparative modeling

    • SWISS-MODEL for homology modeling based on aryl alcohol oxidase or other related enzymes

    • Critical evaluation of models using QMEAN, ProCheck, and MolProbity

  • Functional Domain Analysis:

    • Catalytic triad/dyad identification for hydrolase activity

    • Substrate binding pocket analysis

    • Comparison with EC 3.1.1.- family members to identify conserved features

    • Signal peptide and transmembrane domain prediction

  • Molecular Dynamics Simulations:

    • Stability analysis in different environments (aqueous, membrane-proximal)

    • Substrate docking and binding free energy calculations

    • Conformational flexibility assessment in relation to function

  • Integration with Experimental Data:

    • Use spectroscopic data (if available) to refine computational models

    • Iterate predictions based on site-directed mutagenesis results

    • Cross-validate predictions using activity assays with different substrates

When implementing these approaches, researchers should consider mimivirus's evolutionary position and potentially unique structural features that may not align with traditional protein families .

How do the evolutionary aspects of MIMI_L446 relate to its potential function in mimivirus biology?

The evolutionary context of MIMI_L446 provides valuable insights into its functional role:

  • Phylogenetic Position:

    • MIMI_L446 should be analyzed in relation to the NCLDV core gene classification system

    • Determine if it belongs to Class I-IV core genes, or if it represents a mimivirus-specific acquisition

    • Based on available data, MIMI_L446 likely represents a gene that is not part of the conserved NCLDV core genome

  • Origin Analysis:

    • Compare with homologs in metagenomic data (e.g., Sargasso Sea dataset)

    • Evaluate potential horizontal gene transfer from prokaryotic or eukaryotic sources

    • Build phylogenetic trees using MEGA3 or similar software to visualize evolutionary relationships

  • Functional Convergence/Divergence:

    • Assess if the lipid hydrolase function represents convergent evolution with cellular enzymes

    • Evaluate selective pressures on the gene using dN/dS ratio calculations

    • Analyze conservation of catalytic residues across homologs

  • Promoter Evolution:

    • Examine the presence/absence of the AAAATTGA motif in MIMI_L446's promoter region

    • Correlate with potential timing of expression (early vs. late genes)

    • Promoter analysis can suggest whether MIMI_L446 falls into the ~45% of mimivirus genes with this conserved motif

  • Structural Domain Evolution:

    • Identify conserved domains shared with other proteins

    • Domain architecture comparison with homologs from other viruses or cellular organisms

    • Assess domain fusion/fission events through evolutionary history

This evolutionary analysis provides context for understanding mimivirus origins and whether MIMI_L446 represents an ancestral viral gene or a more recent acquisition, informing hypotheses about its specific role in viral biology .

What is currently understood about the role of proteins like MIMI_L446 in mimivirus viral factory formation?

Recent research has revealed important insights into mimivirus viral factory (VF) formation:

  • Viral Factory Structure:

    • Mimivirus VFs have a distinct multi-layered organization

    • Two primary compartments: Outer Layer (OL) and Inner Layer (IL)

    • The OL acts as a selective barrier that recruits specific viral proteins

    • The IL contains the viral DNA and transcription-associated proteins

  • Protein Recruitment Mechanisms:

    • Specific scaffold proteins (e.g., OLS1) form the OL structure

    • Client proteins are selectively recruited to either OL or IL

    • DNA-binding proteins like ILS1 are recruited to the IL

    • For MIMI_L446, its localization pattern would need to be experimentally determined, but structural predictions suggesting lipid hydrolase activity might indicate membrane-associated functions

  • Functional Compartmentalization:

    • DNA replication occurs at the interface between OL and IL

    • Transcription and mRNA processing occur in the IL

    • Virion assembly takes place at the OL-IL interface

    • Proteins are specifically localized to support these compartmentalized functions

  • Temporal Dynamics:

    • VFs develop from nucleating points, likely using viral cores

    • The OL is not essential for infection under laboratory conditions

    • The IL can maintain genome protection and basic viral replication

    • DNA synthesis decreases during late stages of infection as virion assembly increases

For uncharacterized proteins like MIMI_L446, localization studies using fluorescent tagging would be crucial to determine whether it associates with the OL, IL, or the interface between them, providing functional clues.

How does MIMI_L446 potentially contribute to mimivirus interactions with host immune responses?

Although MIMI_L446's specific role in host immune interactions remains to be fully characterized, several experimental approaches can help elucidate its potential contribution:

  • TLR4 Pathway Interactions:

    • Research has shown that mimivirus particles can activate TLR4 signaling in human cells

    • This activation leads to increased TLR4 expression and IκBα degradation

    • The viral fibrils appear crucial for this interaction

    • Determine if MIMI_L446 is present in viral fibrils or contributes to their formation

  • Testing Protocol for Immune Response:

    • Expose human lung adenocarcinoma cells (A549) to purified MIMI_L446

    • Assess TLR4 expression changes via immunoblotting

    • Measure IκBα degradation as an indicator of NF-κB pathway activation

    • Compare results with whole virus exposure and fibril-deficient variants (like M4 strain)

  • Comparative Analysis:

    • The virion structure of mimiviruses includes fibrils that are structurally similar to lipopolysaccharides (LPS)

    • These structural similarities may explain TLR4 activation

    • Testing whether MIMI_L446's lipid hydrolase activity modifies these structures could provide functional insights

  • Experimental Evidence from Related Studies:

    • Treatment with polymyxin B, which inactivates LPS, also inhibits mimivirus-induced TLR4 activation

    • This suggests structural similarities between viral components and bacterial LPS

    • MIMI_L446 could potentially modify these components during viral entry or assembly

  • Downstream Signaling Effects:

    • NF-κB translocation following mimivirus exposure leads to proinflammatory cytokine expression

    • Testing whether MIMI_L446 affects this cascade would illuminate its role in pathogenesis

    • Interference with interferon response pathways has been observed in mimivirus infection

What methodological approaches are recommended for studying protein-protein interactions involving MIMI_L446?

For investigating protein-protein interactions (PPIs) of MIMI_L446, researchers should consider these methodological approaches:

  • In Vitro Binding Assays:

    • Pull-down Assays: Using His-tagged recombinant MIMI_L446 as bait protein to capture interaction partners from viral lysates or host cell extracts

    • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics with suspected interaction partners

    • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of protein-protein interactions

    • AlphaScreen/AlphaLISA: For high-throughput screening of potential interaction partners

  • Cell-Based Interaction Studies:

    • Two-way Co-immunoprecipitation: Similar to techniques used for validating NME1-DNM2 interactions

    • Proximity Ligation Assay (PLA): For detecting protein interactions in situ with single-molecule sensitivity

    • Fluorescence Resonance Energy Transfer (FRET): To detect interactions in live cells during infection

    • Bimolecular Fluorescence Complementation (BiFC): For visualizing protein interactions in their cellular context

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinking of interacting proteins followed by MS analysis

    • Identification of specific domains/residues involved in interactions

    • Mapping interaction interfaces at molecular resolution

  • Structural Analysis of Complexes:

    • Cryo-EM for structural determination of MIMI_L446-containing complexes

    • X-ray crystallography for high-resolution structure determination

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Functional Validation:

    • Mutagenesis of key residues identified in interaction interfaces

    • Functional assays to assess the impact of disrupting specific interactions

    • Correlation of interaction patterns with viral factory formation dynamics

For all PPI studies, it's crucial to include appropriate controls to distinguish specific from non-specific interactions, especially considering the complex environment of viral factories.

What are the current challenges and contradictions in research regarding MIMI_L446 and its role in mimivirus biology?

Research on MIMI_L446 and mimivirus biology faces several challenges and contradictions that researchers should address:

  • Functional Annotation Challenges:

    • MIMI_L446 is currently annotated as "uncharacterized," despite structural predictions suggesting lipid hydrolase activity

    • EC number assignment (3.1.1.-) indicates hydrolase activity, but specific substrate preference remains undetermined

    • Resolution approach: Systematic substrate screening with recombinant protein against diverse lipid substrates

  • Evolutionary Origin Contradictions:

    • Conflicting hypotheses exist regarding mimivirus gene origins:

      • Genome reduction from free-living organism

      • Acquisition of host genes with subsequent adaptation

      • Core set of NCLDV genes with extensive expansion

    • MIMI_L446's placement in this evolutionary context remains unresolved

    • Resolution approach: Comprehensive phylogenetic analysis incorporating metagenomic data and diverse viral/cellular homologs

  • Host Range Uncertainties:

    • Laboratory studies focus on amoeba hosts, but structural similarities with lignin-degrading enzymes suggest potential alternative hosts

    • Mammalian cell interaction studies show mimivirus particle internalization without productive infection

    • Resolution approach: Systematic host range testing combined with knockout studies to assess MIMI_L446's contribution to host interaction

  • Viral Factory Localization Data Gaps:

    • Comprehensive mapping of protein localization within viral factories is incomplete

    • MIMI_L446's localization pattern and temporal expression profile are undetermined

    • Resolution approach: Fluorescent tagging studies combined with time-course expression analysis during infection

  • Methodological Limitations:

    • Challenges in generating clean knockouts in large viral genomes

    • Difficulty distinguishing essential from non-essential genes

    • Potential functional redundancy complicating phenotypic analysis

    • Resolution approach: CRISPR-Cas9 genome editing combined with conditional expression systems and complementation studies

Addressing these challenges requires interdisciplinary approaches combining structural biology, evolutionary genomics, cell biology, and biochemical characterization to develop a comprehensive understanding of MIMI_L446 in mimivirus biology.

What are the optimal conditions for enzymatic assays to characterize MIMI_L446's predicted lipid hydrolase activity?

Based on its predicted function as a lipid hydrolase (EC 3.1.1.-), the following protocol recommendations are provided for enzymatic characterization of MIMI_L446:

  • Buffer Optimization:

    • pH Range: Test activity across pH 5.0-9.0 using different buffer systems:

      • Acetate buffer (pH 5.0-5.5)

      • MES buffer (pH 5.5-6.5)

      • Phosphate buffer (pH 6.5-7.5)

      • Tris buffer (pH 7.5-9.0)

    • Ionic Strength: Test NaCl concentrations from 0-500 mM

    • Divalent Cations: Include assays with/without Ca²⁺, Mg²⁺, and Zn²⁺ (0.5-5 mM)

  • Substrate Selection Panel:

    Substrate TypeExample CompoundsDetection Method
    p-Nitrophenyl esterspNP-acetate, pNP-butyrate, pNP-palmitateSpectrophotometric (405 nm)
    TriglyceridesTriolein, tributyrinpH-stat, fatty acid release
    PhospholipidsDOPC, DPPC, DPPEHPLC, mass spectrometry
    Fluorogenic substrates4-MU-oleate, Pyrene-labeled lipidsFluorescence
  • Reaction Conditions:

    • Temperature Range: 25°C, 30°C, 37°C, and 42°C

    • Enzyme Concentration: 0.1-10 μg/mL of purified protein

    • Reaction Time: 5-60 minutes with sampling at regular intervals

    • Substrate Concentration: 0.1-2 mM for kinetic parameter determination

  • Inhibitor Profiling:

    • Serine hydrolase inhibitors (PMSF, 3,4-dichloroisocoumarin)

    • Metal chelators (EDTA, EGTA)

    • Specific lipase inhibitors (Orlistat, THL)

    • Substrate competition assays

  • Data Analysis:

    • Determine Km, kcat, and catalytic efficiency (kcat/Km)

    • Compare substrate preference profile with known lipases/esterases

    • Generate pH and temperature activity profiles

    • Assess cofactor requirements and inhibition patterns

For reliable results, include positive controls (commercial lipases of known specificity) and negative controls (heat-inactivated enzyme, buffer-only reactions).

How can researchers address expression and purification challenges specific to MIMI_L446?

Researchers working with MIMI_L446 may encounter specific challenges during expression and purification. Here are methodological solutions:

  • Expression Optimization Strategies:

    • Codon Optimization: Mimivirus genes may contain rare codons; use optimized constructs for E. coli expression

    • Expression Vector Selection:

      • pET vector series with T7 promoter for high-level expression

      • pGEX vectors for GST-fusion to improve solubility

      • pMal vectors for MBP-fusion if solubility remains problematic

    • Expression Host Strains:

      • BL21(DE3) for standard expression

      • Rosetta or CodonPlus strains for rare codon supplementation

      • Origami or SHuffle strains if disulfide bonds are necessary

  • Solubility Enhancement Techniques:

    • Induction Conditions:

      • Lower temperature induction (16-20°C overnight)

      • Reduced IPTG concentration (0.1-0.5 mM)

      • Auto-induction media for gradual protein expression

    • Fusion Partners:

      • Thioredoxin, SUMO, or NusA tags for enhancing solubility

      • Cleavable tags with precision protease sites

    • Buffer Additives:

      • 5-10% glycerol to stabilize hydrophobic regions

      • 0.1-1% non-ionic detergents for membrane-interacting proteins

      • 50-500 mM amino acid additives (arginine, glutamate)

  • Purification Troubleshooting:

    • IMAC Optimization:

      • Test multiple metal ions (Ni²⁺, Co²⁺, Cu²⁺) for optimal binding

      • Include 5-20 mM imidazole in binding buffer to reduce non-specific binding

      • Use step gradient elution to separate full-length protein from truncated forms

    • Additional Purification Steps:

      • Ion exchange chromatography based on theoretical pI

      • Hydrophobic interaction chromatography for separation from E. coli proteins

      • Size exclusion chromatography as final polishing step

  • Protein Stability Enhancement:

    • Storage Buffer Optimization:

      • Tris/PBS-based buffer with 6% trehalose at pH 8.0

      • Addition of 50% glycerol for freeze-thaw stability

      • Small molecule additives (TCEP, arginine, glutamate)

    • Aliquoting Strategy:

      • Store small aliquots to minimize freeze-thaw cycles

      • Working stocks at 4°C for up to one week

  • Activity Preservation:

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for long-term storage

    • Activity assays before and after storage to monitor stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.