Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L448 (MIMI_L448)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L448 (MIMI_L448) is a protein found in the Acanthamoeba polyphaga mimivirus (APMV), a giant virus that infects amoeba . APMV possesses a large genome encoding for numerous proteins, some of which have unknown functions . Research suggests that certain uncharacterized proteins within Mimivirus are essential for the generation of infectious viral particles .

Discovery and Background

The Acanthamoeba polyphaga mimivirus (APMV) was initially discovered in 2003 . The discovery of APMV revealed the presence of various proteins and RNA within the virion . The roles of these proteins and RNA are suggested to be linked to the early stages of infection, but have not been thoroughly investigated .

Function and Significance

MIMI_L448 is one of the many uncharacterized proteins encoded by the mimivirus genome . Studies using microinjection of mimivirus DNA into Acanthamoeba castellanii have identified several uncharacterized proteins, including L442, L724, L829, and R387, that are necessary for DNA-mediated APMV generation . Protein analysis using SDS-PAGE revealed five putative protein bands, with band no. 3 containing the cleaved sequence of the uncharacterized protein L442, which has a size between 43 and 55,223 kDa . Other mimivirus proteins identified include GMC-type oxidoreductase R135, uncharacterized protein R387, and uncharacterized proteins L724 and L829 .

Experimental Analysis

To investigate the necessity of proteins associated with APMV DNA for viral production, researchers have used proteinase K to eliminate residual proteins from extracted DNA . Microinjection experiments with and without proteinase K pre-treatment showed that viral production occurred in experiments without proteinase K treatment, whereas experiments with proteinase K pre-treated APMV DNA did not lead to amoeba monolayer lysis associated with APMV particle production .

Tables

Protein NameMolecular Weight (kDa)
Uncharacterized protein L44243-55,223
GMC-type oxidoreductase R13576,947
Uncharacterized protein R38730,067
Uncharacterized protein L72424,033
Uncharacterized protein L82949,226
ExperimentViral Production
Microinjection without Proteinase K treatmentYes
Microinjection with Proteinase K pre-treatmentNo

It is important that tables are constructed in a way that they are easily understood on their own, without needing to refer to the main text of the article .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MIMI_L448; Uncharacterized protein L448
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L448
Target Protein Sequence
MYSNITKAWHEDPVKEITSKLSKGYFNANKNNKFENERSSEISDKILDKNPKYNFLSTES DLVSLTENNLHLLSNNSAHISDLNSSEFGNYAPVDFATKIKPHNISNKHLPLVSSKDSEC DFSMNHIKHCNICYGRLKELINNKVSKKMDEIILDNKIKQIQSFVPSLDNLSKSNLTTDQ SMNNQNRNTISNNDLWKTALIIIIGIVIILLLIIVMIKTVCK
Uniprot No.

Target Background

Database Links

KEGG: vg:9925072

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.