Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L536 (MIMI_L536)

Shipped with Ice Packs
In Stock

Description

Overview of Acanthamoeba polyphaga Mimivirus

Acanthamoeba polyphaga Mimivirus (APMV) is a giant virus that infects amoebae and was first reported in 2003 . Its DNA genome encodes nearly 1,000 proteins, including enzymes for synthesizing the unusual sugar 4-amino-4,6-dideoxy-d-glucose, also known as d-viosamine . The pathway for producing this sugar begins with a nucleotide-linked sugar, believed to be UDP-d-glucose in Mimivirus .

Uncharacterized Proteins in Mimivirus

The discovery of APMV revealed many proteins and RNAs within the virion . Researchers have hypothesized that these components play a role in the early stages of infection, though this has not been fully validated . Research has identified several uncharacterized proteins, including L442, L724, L829, and R387, and a putative GMC-type oxidoreductase R135, that are believed to be involved in DNA-mediated APMV generation .

Protein L136: A Mimivirus Aminotransferase

The enzyme responsible for installing the amino group at the C-4' position of the pyranosyl moiety is encoded by the L136 gene in Mimivirus . L136 is a pyridoxal 5'-phosphate-dependent enzyme . Structural and functional analysis, including high-resolution X-ray structures, have been performed on L136 . Kinetic parameters of the enzyme show efficiency with both UDP-d-glucose and dTDP-d-glucose substrates . The three-dimensional structure of L136 is the first model for a virally encoded PLP-dependent enzyme, offering new insights into sugar aminotransferases .

Research Techniques

  1. X-ray Crystallography: This technique is used to determine the three-dimensional structure of proteins, as demonstrated in the structural analysis of L136 .

  2. Bioinformatics: Bioinformatics tools and web servers are used for protein structure and function prediction .

  3. Mass Spectrometry: Matrix-assisted laser desorption/ionization time-of-flight and liquid chromatography-mass spectrometry are used to identify proteins .

  4. NMR Spectroscopy: Nuclear Magnetic Resonance methods are used to study the binding interactions and dynamics of proteins, particularly intrinsically disordered proteins .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L536; Uncharacterized protein L536
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L536
Target Protein Sequence
MYGIYIHDELTINDTELSMDKLCSGIVENQSKCIAVSINSSNIISDLNMSVRKIIYKFGT NRYLFYYYNSKWYTDIHHILSLMDLSLGSFISELQKYYPECDLTMWILRGDGMCIHRKLI DLETMTKIILSFNSNFTRCFKAECIYHMAIVYILIMYQIYILSLIRINT
Uniprot No.

Target Background

Database Links

KEGG: vg:9925168

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does MIMI_L536 compare to other mimivirus proteins?

Unlike characterized mimivirus proteins such as gp275 (which functions as an MC1-like non-histone architectural protein involved in DNA condensation) or L375 (a Nudix enzyme that hydrolyzes the 5' mRNA cap), MIMI_L536 remains functionally uncharacterized .

Comparative analysis table of selected mimivirus proteins:

ProteinFunctionSize (aa)CharacterizedLocation
MIMI_L536Unknown169NoUnknown
gp275 (R252)DNA architectural proteinUnknownYesViral factory, virion
L375mRNA decapping (Nudix enzyme)UnknownYesUnknown
R561 (OLS1)Outer Layer Scaffold proteinUnknownYesViral factory outer layer
R252 (ILS1)Inner Layer Scaffold protein, DNA bindingUnknownYesViral factory inner layer

This comparison highlights the current knowledge gap regarding MIMI_L536 compared to other mimivirus proteins that have defined functions in the viral replication cycle .

How should I design experiments to determine the function of MIMI_L536?

A comprehensive experimental design approach should include:

  • Gene knockout studies:

    • Generate a knockout mutant using homologous recombination in Acanthamoeba cells

    • Design complementation experiments with transgenic Acanthamoeba lines expressing a codon-optimized version of MIMI_L536

    • Compare viral replication efficiency, viral factory formation, and virion production between wild-type and knockout viruses

  • Protein localization studies:

    • Create fluorescent protein fusions (e.g., EGFP-tagged MIMI_L536)

    • Perform time-course infection experiments using fluorescence microscopy

    • Co-localize with known viral factory markers like DAPI (DNA) and other tagged proteins

  • Protein-protein interaction studies:

    • Conduct co-immunoprecipitation experiments using formaldehyde crosslinking

    • Perform mass spectrometry analysis to identify binding partners

    • Verify interactions with candidate proteins using techniques like fluorescence resonance energy transfer (FRET)

This multifaceted approach follows established protocols that have successfully characterized other mimivirus proteins such as gp275 and viral factory scaffold proteins .

What controls are essential when working with recombinant MIMI_L536?

When working with recombinant MIMI_L536, include these critical controls:

  • Expression controls:

    • Empty vector control expressing the same tag without MIMI_L536

    • Expression of a well-characterized mimivirus protein (e.g., gp455) with the same tag

    • Wild-type untagged control

  • Functional assays controls:

    • Positive control: Known DNA-binding protein (if testing DNA interactions)

    • Negative control: Non-relevant protein expressed under identical conditions

    • Buffer-only control

  • Localization experiment controls:

    • GFP or RFP-only expression to control for random localization

    • Co-expression with known viral factory proteins (e.g., gp455-RFP)

    • DAPI staining to visualize DNA in the viral factory

These controls are based on methodologies successfully employed in studies of mimivirus protein gp275, where researchers used tagged gp455 as a control and co-localization marker .

How can I optimize protein expression conditions for MIMI_L536?

Based on successful expression of other mimivirus proteins, consider these methodological approaches:

  • E. coli expression system optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Vary induction parameters: IPTG concentration (0.1-1.0 mM), temperature (16°C, 25°C, 37°C), and duration (4h vs. overnight)

    • Compare solubility with different fusion tags (His, GST, MBP, SUMO)

  • Expression condition screening:

    E. coli StrainTemperatureIPTG ConcentrationInduction TimeExpected Outcome
    BL21(DE3)37°C1.0 mM4 hoursHigh expression, possible inclusion bodies
    BL21(DE3)16°C0.1 mMOvernightLower expression, higher solubility
    Rosetta25°C0.5 mM6 hoursModerate expression, improved folding
  • Purification strategy:

    • Initial IMAC purification (for His-tagged protein)

    • Secondary purification step (ion exchange or size exclusion chromatography)

    • Buffer optimization to maintain protein stability

This approach is based on established protocols for recombinant expression of mimivirus proteins such as ILS1 and OLS1, which were successfully expressed and purified from E. coli for functional studies .

How can I determine if MIMI_L536 interacts with viral or host DNA?

To characterize potential DNA interactions:

  • In vitro DNA binding assays:

    • Electrophoretic mobility shift assay (EMSA) with labeled DNA fragments

    • DNA protection assay using DNase I footprinting

    • Surface plasmon resonance (SPR) to measure binding kinetics

  • DNA specificity testing:

    • Compare binding to viral genomic DNA vs. host DNA

    • Test different DNA structures (linear, circular, single-stranded)

    • Vary DNA concentration to assess concentration dependence, as observed with ILS1

  • Microscopy-based approaches:

    • Co-localization of fluorescently-tagged MIMI_L536 with DNA during infection

    • Live-cell imaging using techniques like EU (for RNA) or EdU (for DNA) labeling

    • Super-resolution microscopy to precisely locate MIMI_L536 within viral factories

Apply methodological considerations demonstrated with ILS1, which showed DNA-dependent phase separation that varied with DNA concentration and topology .

What approaches can reveal if MIMI_L536 undergoes phase separation in viral factories?

Based on recent findings with mimivirus scaffold proteins:

  • In vitro phase separation assays:

    • Test recombinant MIMI_L536 at different concentrations (50-500 μM)

    • Vary buffer conditions (salt concentration, pH, temperature)

    • Add potential co-factors (DNA, RNA, other viral proteins)

    • Use microscopy to visualize biomolecular condensate formation

  • Quantitative analysis:

    MIMI_L536 ConcentrationSalt ConcentrationDNA PresentExpected Outcome
    100 μM150 mM NaClNoTest for intrinsic phase separation
    100 μM150 mM NaClYesTest for DNA-enhanced phase separation
    100 μM500 mM NaClYesTest salt sensitivity of condensates
  • In vivo approaches:

    • Express fluorescently-tagged MIMI_L536 in Acanthamoeba

    • Use fluorescence recovery after photobleaching (FRAP) to assess protein dynamics

    • Co-express with known phase-separating proteins like OLS1 to test for co-condensation

This methodological approach is based on successful phase separation studies of mimivirus proteins OLS1 and ILS1, which form the scaffold of viral factories through phase separation .

How might MIMI_L536 contribute to the mimivirus replication cycle?

Based on studies of other mimivirus proteins, several hypotheses can be tested:

  • Potential roles in viral factory formation:

    • Co-localization with viral factory markers at different time points (6h, 8h post-infection)

    • Knockout impact on viral factory morphology and development

    • Interaction with known viral factory proteins like OLS1 or ILS1

  • Possible involvement in viral genome processes:

    • DNA binding and condensation (similar to gp275)

    • RNA processing or cap modification (similar to L375)

    • Structural role in virion assembly

  • Systematic testing methodology:

    • Time-course expression analysis during infection

    • Mass spectrometry to identify MIMI_L536 in different viral compartments

    • Functional complementation assays with knockout viruses

These approaches mirror successful functional characterization of other mimivirus proteins, such as gp275, which was shown to be essential through knockout experiments and localized to viral factories through microscopy .

What are the optimal strategies for purifying recombinant MIMI_L536?

Based on successful purification of other mimivirus proteins:

  • Expression and initial purification:

    • His-tagged MIMI_L536 expression in E. coli

    • Lysis in appropriate buffer (e.g., 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole)

    • Initial purification using Ni-NTA affinity chromatography

  • Advanced purification:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography if additional purity is required

    • Consider tag removal if the tag interferes with functional assays

  • Quality control assessment:

    • SDS-PAGE to verify purity (aim for >95%)

    • Western blot to confirm identity

    • Dynamic light scattering to assess homogeneity

    • Mass spectrometry to confirm molecular weight and sequence

This purification strategy is based on protocols used for successful purification of mimivirus proteins like ILS1 and OLS1 for in vitro functional studies .

How can I design gene knockout experiments for MIMI_L536?

Based on successful mimivirus gene knockout strategies:

  • Knockout construct design:

    • Homologous recombination strategy with flanking regions (~500bp each)

    • Replace MIMI_L536 with a selectable marker or fluorescent reporter

    • Design PCR primers for screening recombinant viruses

  • Transfection and selection approach:

    • Generate trans-complementing Acanthamoeba cell line expressing codon-optimized MIMI_L536

    • Transfect knockout construct into Acanthamoeba cells

    • Isolate and verify recombinant viruses through PCR and sequencing

  • Phenotypic analysis:

    • Compare viral replication in wild-type vs. complementing cells

    • Assess viral factory formation using DAPI staining

    • Quantify viral particle production by flow cytometry and electron microscopy

This approach follows the methodology used for successful knockout of OLS1, which demonstrated its importance in viral factory formation and viral replication .

What microscopy techniques are most informative for studying MIMI_L536 localization?

Recommended microscopy approaches based on successful mimivirus studies:

  • Fluorescence microscopy methods:

    • Confocal microscopy for co-localization with viral factory markers

    • Live-cell imaging to track dynamics during infection

    • Super-resolution microscopy (STED, STORM) for precise localization

  • Sample preparation protocols:

    • Fixed samples: 4% paraformaldehyde fixation, permeabilization with 0.1% Triton X-100

    • Live imaging: Expression of fluorescent protein fusions in Acanthamoeba cells

    • Specific labeling: Use antibodies against MIMI_L536 or epitope tags

  • Quantitative analysis:

    • Co-localization coefficients (Pearson's, Mander's)

    • Time-course intensity measurements

    • FRAP analysis for protein dynamics

These methods are based on successful approaches used to study the localization of gp275-EGFP and gp455-RFP in mimivirus-infected cells, which revealed their co-localization with viral DNA in the viral factory .

How can computational approaches predict MIMI_L536 function?

Advanced computational strategies include:

  • Structural prediction methods:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Molecular dynamics simulations to study protein flexibility

    • Template-based modeling using structures of related proteins

  • Functional prediction approaches:

    • Sequence motif identification using MEME, PROSITE

    • Comparative genomics across different mimiviruses

    • Protein-protein interaction prediction with STRING, STITCH

  • Integrative analysis workflow:

    • Initial sequence analysis (conserved domains, disorder prediction)

    • Secondary structure prediction and fold recognition

    • 3D structure modeling and validation

    • Function prediction based on structural similarities

These computational approaches can provide valuable hypotheses about MIMI_L536 function to guide experimental design, similar to the identification of the MC1 domain in gp275 which led to its characterization as a DNA architectural protein .

How might MIMI_L536 interact with the phase-separated viral factory?

Based on recent advances in understanding mimivirus viral factories:

  • Phase separation interaction studies:

    • Test co-phase separation with OLS1 and ILS1 in vitro

    • Examine recruitment to pre-formed biomolecular condensates

    • Analyze partition coefficients in different phases of the viral factory

  • Localization within the viral factory architecture:

    • Determine if MIMI_L536 localizes to the inner layer (IL) or outer layer (OL)

    • Test interaction with DNA within the viral factory

    • Analyze temporal dynamics during viral factory development

  • Functional impact assessment:

    • Evaluate effect of MIMI_L536 on phase separation properties of viral factory components

    • Test impact on viral processes (replication, transcription) within the viral factory

    • Analyze recruitment of other viral or host factors to the viral factory

This research direction builds on recent findings about the biphasic nature of mimivirus viral factories, where proteins like OLS1 and ILS1 create distinct layers through phase separation processes .

What advanced mass spectrometry approaches can identify MIMI_L536 post-translational modifications?

State-of-the-art mass spectrometry approaches include:

  • Sample preparation strategies:

    • Enrichment of MIMI_L536 through immunoprecipitation

    • Specific digestion methods (trypsin, chymotrypsin, GluC)

    • Phosphopeptide enrichment using TiO₂ or IMAC

  • MS analysis methods:

    • LC-MS/MS using high-resolution instruments (Orbitrap, Q-TOF)

    • Multiple fragmentation methods (HCD, ETD, EThcD)

    • Data-independent acquisition (DIA) for comprehensive coverage

  • Data analysis workflow:

    • Database searching with variable modifications

    • Spectral validation and manual verification

    • Quantification of modification stoichiometry

This approach is based on successful MS identification of mimivirus proteins in complex samples, such as the identification of L442, L724, L829, R387, and R135 in DNA-associated protein fractions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.