Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L573 (MIMI_L573)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized Protein L573 (MIMI_L573)

Acanthamoeba polyphaga Mimivirus (APMV) is a giant virus known for its large size and genomic complexity . Its genome encodes numerous proteins, many of which have unknown functions . Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L573 (MIMI_L573) is one such protein, produced using recombinant DNA technology for research purposes .

Characteristics of MIMI_L573

MIMI_L573 is a protein of unknown function from the Mimivirus, expressed in E. coli and tagged with N-terminal His . The full-length recombinant protein consists of 244 amino acids . Due to its uncharacterized nature, research is focused on elucidating its potential role within the virus's life cycle and its interactions with the host cell.

Production of Recombinant MIMI_L573

Recombinant MIMI_L573 is produced using E. coli as the expression host . The gene encoding MIMI_L573 is cloned into an expression vector and introduced into E. coli cells. The protein is then purified using affinity chromatography, taking advantage of the His tag .

Role of Uncharacterized Proteins in Mimivirus

Mimivirus contains a significant number of uncharacterized proteins, including MIMI_L573 . These proteins may play roles in:

  • Infection Process: Some proteins and RNA within the virion are suggested to be associated with the early stages of infection .

  • Virion Structure: Contributing to the structural integrity and assembly of the viral particle .

  • Host Interaction: Modulating host cell functions or evading host defenses .

Protein Structures

Proteins have four levels of structural organization that dictate their function .

Research Significance

Characterizing proteins like MIMI_L573 is crucial for understanding the complete biology of Mimivirus . Functional analysis of these proteins can provide insights into novel mechanisms of viral infection and replication, potentially leading to the development of antiviral strategies.

Methods for Studying Mimivirus Proteins

  • Microinjection: Directly transfecting mimivirus DNA into Acanthamoeba castellanii to generate infectious APMV virions .

  • SDS-PAGE and Mass Spectrometry: Analyzing protein composition and identifying specific proteins within the virion .

  • Transcriptome Analysis: Examining the changes in host and virus transcriptomes during infection to understand gene expression dynamics .

  • Electron Microscopy: Observing the structure and behavior of Mimivirus particles .

Data Table: MIMI_L573 Information

FeatureDescription
Protein NameRecombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L573
Alternate NameMIMI_L573
Source VirusAcanthamoeba polyphaga Mimivirus
Expression HostE. coli
Amino Acid Length244 aa
TagN-terminal His tag
Molecular WeightApproximately 27 kDa (estimated based on amino acid count)
FunctionUncharacterized
Potential FunctionsViral infection, virion structure, host interaction
ApplicationsResearch in virology, protein characterization, drug discovery
Example ApplicationUsed in microinjection experiments to study mimivirus replication

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L573; Uncharacterized protein L573
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L573
Target Protein Sequence
MDNTHLIESSLRHQFLTMFRTDNAFIDGILTVMIISLLSYIVKQFSDLPSVIGNIYNKIM IKIRLFFRPKSADKISKTTIIESLSEDKKPNELYTAVYWFLTTNIDLTVDSNVKMSFTKK IELDEYKELKDKNINKNMSYGTKKIFNYTHNNMTFEIEYFFATNLVSVYTDKKRDKENHI IYLTTLIDPNIRFDVFEEFTKMCMREYAKSLVDKKWVQKIFTNNNGRWTETVFITDVNLN SYFA
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Acanthamoeba polyphaga mimivirus and why is protein L573 significant?

Acanthamoeba polyphaga mimivirus (APMV) is a giant virus discovered in 2003 that infects Acanthamoeba castellanii amoeba. It contains a large double-stranded DNA genome encoding numerous proteins, many of which remain uncharacterized, including L573. The significance of uncharacterized proteins like L573 lies in understanding the complete functional repertoire of the mimivirus, especially given the virus's unusual complexity and the presence of numerous proteins and RNA within the virion that may be involved in early infection stages . Similar to other uncharacterized proteins found in APMV (such as L442, L724, L829, and R387), L573 may play critical roles in viral replication, host interaction, or other processes that contribute to mimivirus biology .

How does L573 compare to other characterized mimivirus proteins?

Unlike some mimivirus proteins that have been characterized (such as the GMC-type oxidoreductase R135 mentioned in literature), L573 remains largely uncharacterized . Comparative analysis with other mimivirus proteins reveals that uncharacterized proteins often fall into several categories: structural components of the virion, proteins involved in DNA replication/transcription, host interaction factors, or proteins with entirely novel functions. The following table presents a comparison of L573 with other mimivirus proteins that have been studied:

ProteinFunction StatusKnown/Predicted RoleMolecular Weight (kDa)Associated with Virion
L573UncharacterizedUnknownTo be determinedTo be determined
L442Partially characterizedProtein-DNA interaction~50 kDaYes
L724Partially characterizedUnknown~80 kDaYes
L829Partially characterizedUnknown~90 kDaYes
R387Partially characterizedUnknown~45 kDaYes
R135CharacterizedGMC-type oxidoreductase~60 kDaYes

Further investigations into L573 would help complete our understanding of the functional relationships among mimivirus proteins.

What are the primary methods for expressing recombinant mimivirus proteins?

Recombinant expression of mimivirus proteins, including L573, typically employs several complementary approaches. The most common method involves cloning the target gene into expression vectors (such as pET or pGEX systems) for heterologous expression in Escherichia coli. For proteins that require eukaryotic post-translational modifications, expression systems such as insect cells (using baculovirus vectors) or mammalian cells (using plasmid transfection) may be more appropriate.

For mimivirus proteins specifically, researchers should consider:

  • Codon optimization for the expression host

  • Addition of affinity tags (His, GST, MBP) to facilitate purification

  • Expression conditions that minimize protein aggregation

  • Solubility enhancement strategies when working with viral proteins

The expression system choice should be guided by the intended downstream applications, such as structural studies, functional assays, or antibody generation.

How can single-cell transfection techniques be adapted to study MIMI_L573 function?

Single-cell transfection methodologies, particularly microinjection techniques demonstrated with other mimivirus components, offer powerful approaches to studying L573 function. As demonstrated with other mimivirus proteins, microinjection can be adapted to deliver recombinant L573 or its expression constructs directly into Acanthamoeba castellanii cells to observe functional effects . This approach allows for precise control over protein delivery while maintaining the natural host environment.

The methodology involves:

  • Preparation of purified recombinant L573 protein or expression plasmids

  • Microinjection setup with fine glass capillaries (0.5-1 μm diameter tips)

  • Injection of individual amoeba cells under microscopic guidance

  • Time-lapse monitoring of cellular responses and protein localization

  • Comparative analysis with control injections

This technique is particularly valuable for L573 characterization as it bypasses challenges associated with traditional transfection methods in amoeba. Furthermore, co-injection with other viral components can reveal functional interactions within the mimivirus proteome.

What approaches can resolve contradictory findings about mimivirus protein functions?

Resolving contradictions in findings about mimivirus proteins requires systematic context analysis and methodological standardization. When evaluating contradictory results about L573 or related proteins, researchers should:

  • Examine experimental context thoroughly, including species, temporal factors, and environmental conditions

  • Normalize protein nomenclature and gene/protein identifiers to ensure consistent identification across studies

  • Develop standardized assay systems to minimize technical variability

  • Implement computational approaches for contradiction detection in published literature

  • Consider creating a corpus of potentially contradictory claims specific to mimivirus research

Contradictions often arise from underspecified contexts or differences in experimental conditions. For example, expression of viral proteins may vary significantly depending on host cell type, infection stage, or environmental factors. A systematic approach to contextualizing findings using structured metadata can help resolve apparent contradictions.

How does protein L573 potentially interact with host cell machinery?

While specific information about L573 interactions is limited, methodological approaches to study potential host interactions can be outlined based on strategies used for other mimivirus proteins. Researchers investigating L573-host interactions should consider:

  • Affinity purification coupled with mass spectrometry (AP-MS) to identify host protein binding partners

  • Yeast two-hybrid screening against host cell protein libraries

  • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins in the cellular context

  • Subcellular localization studies using fluorescently tagged L573

  • Functional perturbation assays following L573 expression in host cells

The identification of protein-protein interactions would significantly advance our understanding of L573's role during viral infection and potentially reveal novel therapeutic targets for intervention.

What is the optimal experimental design for characterizing the function of MIMI_L573?

Designing robust experiments to characterize the function of uncharacterized proteins like L573 requires a multi-faceted approach that integrates several complementary methods. An optimal experimental design would include:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction and domain identification

    • Evolutionary analysis across related viruses

  • Expression and purification:

    • Recombinant expression in bacterial and eukaryotic systems

    • Affinity chromatography and size exclusion purification

    • Verification of protein folding through circular dichroism

  • Functional assays:

    • Biochemical activity tests (e.g., nuclease, protease, or enzymatic activity)

    • Binding assays with viral DNA, RNA, or other viral proteins

    • Host cell perturbation following expression or microinjection

  • Structural characterization:

    • X-ray crystallography or cryo-electron microscopy

    • NMR spectroscopy for dynamics information

    • Hydrogen-deuterium exchange mass spectrometry for conformational insights

How should researchers design transfection experiments to study L573 in the context of viral infection?

Transfection experiments to study L573 within the context of viral infection require careful consideration of temporal and spatial factors. Based on successful approaches with other mimivirus proteins, a methodical design should include:

  • Preparation phase:

    • Generate expression constructs with appropriate promoters for amoeba cells

    • Include epitope tags that don't interfere with protein function

    • Prepare mimivirus DNA for co-transfection experiments

  • Execution phase:

    • Implement microinjection for precise delivery to individual amoeba cells

    • Establish timing relative to viral infection (pre-infection, concurrent, post-infection)

    • Include appropriate controls (non-functional L573 mutants, other mimivirus proteins)

  • Analysis phase:

    • Monitor viral replication efficiency through plaque assays or qPCR

    • Track protein localization using immunofluorescence or live-cell imaging

    • Assess changes in host cell phenotype and survival

This experimental approach allows researchers to distinguish between L573's potential roles in early infection, replication, assembly, or release stages of the viral life cycle.

What controls are essential when studying DNA-protein interactions involving L573?

When investigating potential DNA-protein interactions involving L573, several critical controls must be included to ensure reliable and interpretable results:

  • Positive controls:

    • Known DNA-binding proteins from mimivirus (such as L442)

    • Well-characterized DNA-binding proteins with similar predicted domains

  • Negative controls:

    • Heat-denatured L573 protein

    • Non-DNA-binding proteins of similar size and charge characteristics

    • Scrambled or non-specific DNA sequences

  • Specificity controls:

    • Competition assays with unlabeled DNA

    • Mutational analysis of potential DNA-binding domains

    • Proteinase K digestion to verify protein-dependent interactions

  • Technical controls:

    • Buffer-only conditions

    • Tag-only protein constructs if using tagged L573

    • Concentration gradient series to establish binding kinetics

The integration of these controls helps distinguish specific L573-DNA interactions from non-specific associations and technical artifacts, particularly important when characterizing previously uncharacterized proteins.

How can contradictory data about L573 function be systematically analyzed?

Systematic analysis of contradictory data regarding L573 function requires structured approaches to identify sources of variation and reconcile disparate findings. Researchers should:

  • Implement context analysis methodology:

    • Extract experimental parameters from each study (host cell type, protein preparation, assay conditions)

    • Normalize protein identifiers and nomenclature across studies

    • Categorize contradictions by type (complete contradiction, partial contradiction, incomplete context)

  • Apply computational approaches:

    • Use natural language processing to detect contradictory claims in the literature

    • Develop support vector machine models trained on examples of contradictions

    • Implement polarity computation to identify conflicting event statements

  • Establish a standardized framework:

    • Create a specialized corpus of potentially contradictory claims about L573

    • Develop yes/no questions about L573 function to evaluate across studies

    • Classify relation types into excitatory, inhibitory, and associative categories

This methodical approach transforms seemingly contradictory findings into opportunities for deeper understanding of context-dependent protein functions.

What statistical approaches are most appropriate for analyzing L573 functional assay data?

Statistical analysis of functional assay data for L573 requires approaches that account for biological variability while maintaining statistical power. Recommended statistical methodologies include:

  • For screening experiments:

    • Factorial design analysis to evaluate multiple factors simultaneously3

    • Principal component analysis to identify patterns in multivariate data

    • Cluster analysis to group similar functional outcomes

  • For confirmatory experiments:

    • Analysis of Variance (ANOVA) to assess significant differences between conditions3

    • Regression analysis to establish dose-response relationships

    • Mixed-effects models to account for repeated measures and nested data

  • For reproducibility assessment:

    • Meta-analysis approaches to combine data across independent experiments

    • Bayesian methods to incorporate prior knowledge and update confidence

    • Power analysis to determine sample sizes needed for conclusive results

The following table outlines statistical approach selection based on experimental design:

Experimental ApproachRecommended Statistical MethodMinimum Sample SizeKey Considerations
Single factor comparisont-test or one-way ANOVAn≥3 per groupVerify normality assumptions
Multi-factor analysisFactorial ANOVAn≥5 per conditionTest for interactions between factors
Dose-responseNonlinear regressionn≥6 concentrationsConsider EC50/IC50 calculations
Time-courseRepeated measures ANOVAn≥4 time pointsAccount for temporal autocorrelation
Multiple endpointsMANOVA or PCAn≥10 totalCorrect for multiple comparisons

How should researchers interpret mass spectrometry data for identifying L573 interacting partners?

Interpretation of mass spectrometry data for identifying L573 interaction partners requires careful filtering and validation to distinguish genuine interactions from background contaminants. A comprehensive interpretation framework includes:

  • Primary data filtering:

    • Implement significance thresholds based on peptide spectral matches

    • Apply fold-change criteria relative to control pull-downs

    • Filter based on reproducibility across biological replicates

  • Contaminant exclusion:

    • Compare against common contaminant databases (CRAPome)

    • Implement bait-specific controls (unrelated viral proteins)

    • Apply isotopic labeling (SILAC, TMT) for quantitative filtering

  • Network construction:

    • Map identified interactions to functional pathways

    • Integrate with known mimivirus protein interaction networks

    • Apply topological analysis to identify high-confidence sub-networks

  • Functional validation:

    • Select top candidates for co-immunoprecipitation confirmation

    • Perform co-localization studies using fluorescence microscopy

    • Evaluate functional relevance through knockdown/knockout studies

This systematic approach to mass spectrometry data interpretation minimizes false positives while revealing biologically significant interaction partners that inform L573 function.

How can researchers evaluate contradictory literature about mimivirus proteins?

Evaluating contradictory literature about mimivirus proteins requires systematic assessment of study quality, methodological details, and contextual factors. Researchers should apply the following framework:

  • Source evaluation using scholarly criteria:

    • Verify scholarly nature through presence of references and citations

    • Assess journal reputation and peer-review standards

    • Evaluate author expertise and institutional affiliations

  • Methodological assessment:

    • Examine experimental design rigor and appropriate controls

    • Evaluate sample sizes and statistical analysis approaches

    • Assess reagent validation (especially antibodies and recombinant proteins)

  • Contextual analysis:

    • Identify species, temporal context, and environmental conditions

    • Note differences in protein preparation and experimental systems

    • Consider chronological progression of understanding in the field

  • Apply the CRAAP test components:

    • Currency: When was the information published?

    • Relevance: How directly does it address L573?

    • Authority: What are the author's credentials?

    • Accuracy: Is the methodology sound?

    • Purpose: Why was the study conducted?

This structured evaluation approach helps researchers navigate contradictory findings and develop a nuanced understanding of the current state of knowledge about L573.

What are the essential components of a research paper characterizing L573 function?

A comprehensive research paper characterizing the previously uncharacterized L573 protein should contain specific components that thoroughly document the discovery process and findings. Essential components include:

This structure ensures comprehensive reporting that facilitates reproduction and extension of the findings by other researchers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.