Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L630 (MIMI_L630)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L630; Probable fatty acid desaturase MIMI_L630
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L630
Target Protein Sequence
MLLTIIDKFIQIVLGYLLSDFIMGIYHWIKDTYFSPFTPIIGKTFIWGSRLHHVRPRYVL EFTDKDLIIDSAKWTLSWIGPLFFWFGLTPFLVTMFIMISLNDVIHKYTHEIDHERPMWA TILQRIGFFQSHDEHHLHHIAPHEINYCPVTPYVNIWLEKINLWRKLESFVEYLTGVKPR AKEYEFVEDEKYPAGIRFLE
Uniprot No.

Target Background

Database Links

KEGG: vg:9925272

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MIMI_L630 and what are its basic properties?

MIMI_L630 is an uncharacterized protein from Acanthamoeba polyphaga mimivirus (APMV). The recombinant form is typically produced as a full-length protein consisting of 200 amino acids, often with a histidine tag to facilitate purification and detection . As an uncharacterized protein, its specific functions remain to be fully elucidated through experimental characterization.

The recombinant version available for research has the following specifications:

ParameterDescription
Source organismAcanthamoeba polyphaga mimivirus (APMV)
Expression systemE. coli
TagHistidine (His)
Protein lengthFull length (1-200 amino acids)
Purification methodAffinity chromatography

How does MIMI_L630 fit into the broader context of mimivirus proteins?

MIMI_L630 belongs to the large collection of proteins encoded by APMV. Mimiviruses contain numerous proteins and RNAs within their virions, many of which are thought to be involved in the early stages of infection . While the specific function of MIMI_L630 remains uncharacterized, it exists in the context of a viral genome that encodes proteins involved in various processes including viral factory formation, genome replication, and virion assembly.

Unlike some better-characterized mimivirus proteins such as L442, L724, L829, and R387, which have been shown to associate with viral DNA and potentially play roles in the infectious process, the specific interactions and pathways involving MIMI_L630 require further investigation .

What expression systems are recommended for producing recombinant MIMI_L630?

E. coli expression systems are predominantly used for recombinant MIMI_L630 production . For optimal expression, consider the following methodological approach:

  • Vector selection: pET or pGEX vectors with T7 promoters are recommended for high-level expression.

  • Host strain selection: BL21(DE3) or Rosetta strains are preferred to account for potential codon bias.

  • Expression conditions:

    • Induction with 0.1-1.0 mM IPTG at OD600 of 0.6-0.8

    • Expression at 16-25°C overnight to enhance solubility

    • Supplementation with rare codon tRNAs may improve expression efficiency

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Size exclusion chromatography for further purification

    • Buffer optimization to maintain protein stability

What structural prediction methods are most reliable for analyzing MIMI_L630?

For uncharacterized viral proteins like MIMI_L630, a multi-tool approach yields the most reliable structural predictions:

  • Ab initio modeling: Tools like Rosetta can generate potential structural models without relying on homology.

  • Tertiary structure prediction: The Phyre2 tool has been successfully used for structure prediction of other mimivirus uncharacterized proteins (L442, L724, L829, and R387) and would be applicable to MIMI_L630 .

  • AlphaFold2 implementation: Recent advances in AI-based structure prediction have significantly improved accuracy for proteins with limited homology data.

  • Validation methodology:

    • Generate models using multiple platforms (I-TASSER, Phyre2, AlphaFold2)

    • Compare predicted models using TM-score or RMSD

    • Validate using Ramachandran plot analysis and PROCHECK

  • Domain identification: Use InterProScan and SMART to identify potential functional domains that may provide insights into MIMI_L630's role.

How can I experimentally determine the structure of MIMI_L630?

Experimental structure determination for MIMI_L630 would follow these methodological steps:

  • X-ray crystallography approach:

    • Protein expression optimization for high yield (10-20 mg/ml)

    • Crystallization screening using commercial kits (Hampton Research, Molecular Dimensions)

    • Crystal optimization through additives and seeding techniques

    • Data collection at synchrotron beamlines for maximum resolution

    • Structure determination through molecular replacement or experimental phasing

  • Cryo-EM alternative:

    • Sample preparation on grids with optimal ice thickness

    • High-resolution data collection on latest generation electron microscopes

    • Image processing and 2D classification followed by 3D reconstruction

    • Model building and refinement

This approach is similar to what would be needed for other mimivirus proteins where expression in vectors followed by X-ray crystallography has been proposed for structural determination .

What methods should be used to identify potential binding partners of MIMI_L630?

To identify interaction partners of MIMI_L630, employ these methodological approaches:

  • Protein-protein interaction screening:

    • Yeast two-hybrid screening against a mimivirus or host protein library

    • Pull-down assays using His-tagged MIMI_L630 as bait

    • Co-immunoprecipitation with antibodies against MIMI_L630

    • Label-free quantitative proteomics to identify binding partners

  • DNA/RNA interaction analysis:

    • Electrophoretic mobility shift assays (EMSA) to test nucleic acid binding

    • Chromatin immunoprecipitation (ChIP) if DNA interaction is suspected

    • RNA immunoprecipitation if RNA interaction is predicted

  • Validation approaches:

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for detection of interactions in solution

Similar approaches have successfully identified interactions for other mimivirus proteins, such as the DNA-associated proteins identified through MALDI-TOF-MS and LC-MS analysis .

How can I determine if MIMI_L630 is associated with mimivirus DNA packaging?

Given that several mimivirus proteins are involved in genome packaging and segregation , MIMI_L630 might have a related function. To investigate this possibility:

  • Proteomic analysis of viral particles:

    • Mass spectrometry analysis of purified virions to determine if MIMI_L630 is present

    • Immunogold labeling and electron microscopy to localize the protein within virions

  • DNA-protein interaction assays:

    • DNase protection assays to identify DNA regions bound by MIMI_L630

    • ChIP-seq to map binding sites across the viral genome

    • In vitro reconstitution of DNA binding with purified components

  • Functional analysis:

    • Creation of conditional knockdowns using antisense RNA

    • Microinjection of purified MIMI_L630 along with viral DNA to observe effects on infectivity

    • Immunodepletion studies to determine if removing MIMI_L630 affects packaging

This methodological approach is based on studies of other mimivirus proteins, where DNA-associated proteins were identified through proteomic analysis and their roles in infection were studied through microinjection experiments .

What is the role of MIMI_L630 in comparison to other DNA-associated mimivirus proteins?

While specific information about MIMI_L630's role is limited, the following approach would help position it within the context of known DNA-associated mimivirus proteins:

  • Comparative proteomic analysis:

    • Expression profile comparison with L442, L724, L829, and R387 during infection

    • Subcellular localization studies using fluorescent tagging

    • Co-immunoprecipitation to determine if MIMI_L630 interacts with these proteins

  • Functional complementation:

    • Testing if MIMI_L630 can complement the function of other proteins when they are depleted

    • Analyzing the effects of combined depletion of multiple proteins

  • Structural comparison:

    • Comparing predicted or experimentally determined structures

    • Identifying shared domains or motifs that might indicate functional similarity

Research on other mimivirus proteins has shown that some, like L442, play significant roles in DNA-protein interactions critical for viral replication . Similar methodologies could determine if MIMI_L630 has comparable functions.

How can I design experiments to determine if MIMI_L630 is essential for mimivirus replication?

To determine the essentiality of MIMI_L630, implement this systematic approach:

  • Gene silencing strategies:

    • RNA interference targeting MIMI_L630 mRNA

    • Antisense oligonucleotides to block translation

    • CRISPR interference to repress transcription

  • Dominant negative approach:

    • Engineer mutated versions of MIMI_L630 that may interfere with wild-type function

    • Express these variants during infection and assess viral replication

  • Microinjection experiments:

    • Follow protocols similar to those used for other mimivirus proteins

    • Compare viral production with and without MIMI_L630

    • Use fluorescent labeling to track the fate of injected components

  • Quantitative assessment:

    • Flow cytometry to quantify viral particles (similar to methods used in studies of other mimivirus proteins)

    • qPCR to measure viral genome replication

    • Plaque assays to determine infectious titer

These methodologies parallel those used to study the roles of other mimivirus proteins in viral replication and assembly .

How does MIMI_L630 potentially interact with host Acanthamoeba proteins?

To investigate MIMI_L630's interactions with host proteins, employ these methodological approaches:

  • Host protein interaction screening:

    • Yeast two-hybrid against an Acanthamoeba cDNA library

    • Affinity purification-mass spectrometry (AP-MS) using MIMI_L630 as bait

    • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity

  • Functional validation:

    • Colocalization studies using fluorescence microscopy

    • Biochemical assays to confirm direct interactions

    • Mutagenesis to identify interaction interfaces

  • Impact on host biology:

    • Transcriptomics and proteomics of host cells expressing MIMI_L630

    • Phosphoproteomics to identify signaling pathways affected

    • Cellular phenotype analysis following MIMI_L630 expression

This approach is based on understanding that mimivirus proteins can interact with host components as part of the infection process, as has been observed with other viral proteins .

What methodologies can be used to study MIMI_L630 in the context of mimivirus viral factories?

Mimivirus replication occurs in viral factories within the host cytoplasm . To study MIMI_L630's role in these structures:

  • Localization studies:

    • Immunofluorescence microscopy with antibodies against MIMI_L630

    • Live-cell imaging with fluorescently tagged MIMI_L630

    • Super-resolution microscopy for detailed localization

  • Temporal dynamics:

    • Time-course analysis of MIMI_L630 expression and localization

    • Pulse-chase experiments to track protein movement during infection

    • Correlation with different stages of viral factory development

  • Functional analysis within viral factories:

    • Microinjection of antibodies against MIMI_L630 into infected cells

    • Localized inactivation using chromophore-assisted light inactivation

    • Correlative light and electron microscopy to link function to ultrastructure

This methodological approach builds on research showing that viral factories are critical sites for mimivirus genome replication and virion assembly .

How does MIMI_L630 compare to proteins in other large DNA viruses?

To position MIMI_L630 in an evolutionary context, employ these comparative approaches:

  • Sequence-based analysis:

    • BLAST and PSI-BLAST searches against viral protein databases

    • Multiple sequence alignment with potential homologs

    • Hidden Markov Model (HMM) profiling to detect distant relationships

  • Structural comparison:

    • Structural alignment with proteins of known function

    • Identification of conserved structural motifs despite sequence divergence

    • Threading algorithms to identify structural similarities

  • Comparative genomics:

    • Synteny analysis to identify conserved gene neighborhoods

    • Presence/absence patterns across different viral lineages

    • Correlation with viral biology and host range

This approach is based on understanding that nucleocytoplasmic large DNA viruses (NCLDVs) often share components of genome packaging and processing machinery, as seen with the prokaryotic-like genome segregation systems in APMV .

What bioinformatic approaches can predict potential functions of MIMI_L630?

For in silico functional prediction of MIMI_L630, implement this multi-faceted approach:

  • Advanced sequence analysis:

    • Motif scanning using PROSITE, PFAM, and SMART

    • Secondary structure prediction with PSIPRED

    • Disordered region prediction with PONDR or IUPred

  • Comparative genomics:

    • Co-occurrence patterns with genes of known function

    • Phylogenetic profiling across viral families

    • Analysis of selection pressure (dN/dS ratios)

  • Network-based approaches:

    • Protein-protein interaction prediction

    • Functional association networks using STRING or similar tools

    • Integration of expression data when available

  • Machine learning applications:

    • Feature-based function prediction

    • Deep learning approaches trained on known viral protein functions

    • Ensemble methods combining multiple predictors

This methodology aligns with approaches used to predict functions of other uncharacterized proteins in large DNA viruses, including the analysis of segregation and packaging components in APMV .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.