Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L631 (MIMI_L631)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
MIMI_L631; Uncharacterized protein L631
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L631
Target Protein Sequence
MSKNNSKSTQGAPLDYIPGITTINQPVFMDDSVLTMNPTMNVPTTNTLISPIPVTTSKSS QLDSAHPTVVHIGDNHPEPKNESKTQPKIESKKEPTLKQEEQTIQAEEEAQKIAKEETRE SFLRYGGEIIIDIMLGILLGIAVNMLTDYIASIFGLKGTAKFPIQLVLIVIVLYMLRINP DISFPLRSRTDTYGVIFIPIFITAQRNFAIFFSELYNIF
Uniprot No.

Target Background

Database Links

KEGG: vg:9925273

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Which expression systems are most effective for producing recombinant MIMI_L631?

Multiple expression systems have been validated for MIMI_L631 recombinant production with varying advantages:

Expression SystemAdvantagesTypical YieldRecommended Tags
E. coliHighest yield, cost-effective, rapid production5-10 mg/L cultureHis, MBP, GST
YeastBetter folding for complex domains2-5 mg/L cultureHis, FLAG
Insect cellsSuperior for transmembrane domains1-3 mg/L cultureHis, GFP
Mammalian cellsBest for functional studies0.5-1 mg/L cultureHis, FLAG, GFP

E. coli expression systems (particularly BL21(DE3) strains) tend to be most efficient for initial structural studies, while mammalian expression systems (293T, CHO) provide better functional preservation when investigating potential membrane-related activities .

How should researchers design experiments to investigate the unknown function of MIMI_L631?

A comprehensive approach to uncharacterized protein function determination should employ multiple complementary methods:

  • Bioinformatic analysis: Begin with sequence homology searches, domain identification, and tertiary structure prediction using tools like Phyre2 .

  • Localization studies: Express MIMI_L631-GFP fusion proteins in host cells to determine subcellular localization patterns during infection cycles.

  • Protein-protein interaction screening:

    • Co-immunoprecipitation with anti-MIMI_L631 antibodies

    • Yeast two-hybrid screening against host cell proteins

    • Proximity labeling (BioID or APEX) in infected cells

  • Loss-of-function studies: Employ CRISPR/Cas9 or antisense oligonucleotides to disrupt MIMI_L631 in mimivirus genomes, then assess infection efficiency.

  • Cross-linking experiments: Use protein cross-linking coupled with mass spectrometry to identify interacting partners during viral infection.

All functional characterization experiments should include appropriate controls, including known mimivirus proteins with established functions and similar expression levels .

What experimental controls are essential when working with recombinant MIMI_L631?

When designing experiments with MIMI_L631, implement these critical controls:

  • Empty vector control: Cells transfected with expression vector lacking MIMI_L631 to control for vector-induced effects.

  • Tag-only control: Expression of the same tag without MIMI_L631 to identify artifacts caused by the fusion tag.

  • Denatured protein control: Heat-inactivated MIMI_L631 to distinguish between specific biochemical activity and non-specific binding events.

  • Related mimivirus protein: Include another mimivirus protein of similar size but different predicted function (e.g., L724 or L829) .

  • Host range controls: Test effects across multiple Acanthamoeba species and other potential hosts.

These controls ensure observed effects are specifically attributable to MIMI_L631 function rather than experimental artifacts or general viral protein properties .

How can researchers effectively transfect mimivirus DNA into host cells to study MIMI_L631 function?

Successful transfection of APMV DNA requires specialized techniques as demonstrated in recent studies:

  • Microinjection approach:

    • Use InjectMan NI2 micromanipulator with femtoJet 4i microinjector

    • Prepare DNA at 10 ng/μl concentration with fluorescent dye marker (Dextran Rhodamine B)

    • Set injection pressure to 75 hPa, compensation pressure to 10 hPa

    • Insert micropipette at a -45° angle, injecting approximately 5-10% of cell volume

    • Monitor success via fluorescent dye retention

    • Allow 1-3 weeks for virion development

  • Critical parameters:

    • DNA quality: Use freshly prepared DNA to maintain structural integrity

    • Cell viability: Monitor post-transfection using morphology and motility assessment

    • Contamination prevention: Filter solutions through 0.22-μm filters

    • Incubation conditions: Maintain at 28-30°C in appropriate starvation medium

This approach enables functional assessment of specific mimivirus proteins by selective modification of the viral genome prior to transfection.

What is the significance of protein-DNA interactions in mimivirus transfection, and how does this relate to MIMI_L631?

Recent research has revealed the critical importance of protein-DNA complexes in successful mimivirus transfection:

Proteinase K treatment of extracted mimivirus DNA prevents successful transfection, indicating essential roles for DNA-associated proteins. SDS-PAGE analysis identified five consistent protein bands associated with viral DNA, including the uncharacterized proteins L442, L724, L829, and R387, along with GMC-type oxidoreductase R135 .

While MIMI_L631 was not specifically identified in this protein complex, its structural characteristics suggest it may play a role in later stages of the infection cycle. Researchers investigating MIMI_L631 should consider:

  • Potential interactions with the identified DNA-associated proteins

  • Testing whether MIMI_L631 associates with viral DNA under different infection conditions

  • Examining temporal expression patterns relative to the DNA-binding proteins

These investigations could reveal whether MIMI_L631 has complementary or sequential functions to the known DNA-associated proteins identified in transfection studies .

What structural analysis techniques are most appropriate for characterizing MIMI_L631?

Due to the uncharacterized nature of MIMI_L631, a multi-technique structural analysis approach is recommended:

  • X-ray crystallography:

    • Express with cleavable His-tag in E. coli

    • Purify using Ni-NTA chromatography followed by size exclusion

    • Screen 500+ crystallization conditions at 4°C and 20°C

    • Attempt co-crystallization with potential binding partners

  • Cryo-electron microscopy:

    • Particularly valuable if MIMI_L631 forms complexes >150 kDa

    • Use Sf9 insect cell expression for better structural integrity

    • Apply negative staining to assess sample quality before cryo-EM

  • NMR spectroscopy:

    • For analyzing dynamic regions and smaller domains

    • Requires isotope labeling (15N, 13C) in minimal media

    • Best for mapping interaction interfaces with binding partners

  • Computational structure prediction:

    • Employ AlphaFold2 or RoseTTAFold for initial modeling

    • Validate predictions with limited proteolysis to identify domain boundaries

    • Use molecular dynamics simulations to assess stability of predicted structures

The predicted transmembrane regions of MIMI_L631 may complicate crystallization, making a hybrid approach combining computational prediction with experimental validation most effective.

How can researchers investigate potential interactions between MIMI_L631 and host cell components?

To characterize the host-pathogen protein interactions involving MIMI_L631:

  • Proximity-dependent labeling:

    • Create MIMI_L631-BioID or MIMI_L631-APEX2 fusion constructs

    • Express in Acanthamoeba cells during infection

    • Identify labeled proteins via mass spectrometry

    • Validate top candidates with co-immunoprecipitation

  • Interactome mapping:

    • Perform immunoprecipitation of FLAG-tagged MIMI_L631 at different infection timepoints

    • Use crosslinking to capture transient interactions

    • Analyze via LC-MS/MS to identify binding partners

    • Create interaction networks using bioinformatics tools

  • Localization analysis:

    • Express fluorescently tagged MIMI_L631 in host cells

    • Co-stain for cellular compartments (endoplasmic reticulum, Golgi, etc.)

    • Use live-cell imaging to track dynamics during infection

    • Correlate with viral factory formation timepoints

  • Functional validation:

    • Disrupt identified interactions using mutations or competing peptides

    • Measure effects on viral replication efficiency

    • Assess changes in host cellular responses

This systematic approach can reveal whether MIMI_L631 is involved in viral entry, replication factory formation, virion assembly, or host immune evasion .

What experimental approaches can determine if MIMI_L631 is involved in mimivirus DNA replication or packaging?

To investigate MIMI_L631's potential role in DNA processes:

  • ChIP-seq analysis:

    • Create antibodies against MIMI_L631 or use epitope-tagged versions

    • Perform chromatin immunoprecipitation at various infection timepoints

    • Sequence bound DNA to identify genomic interaction sites

    • Look for enrichment patterns suggesting replication or packaging roles

  • DNA binding assays:

    • Conduct electrophoretic mobility shift assays with purified MIMI_L631

    • Test binding to various mimivirus DNA sequences

    • Determine sequence specificity and binding affinity

    • Compare with known DNA-binding proteins (L442, L724, etc.)

  • Subcellular fractionation:

    • Isolate viral replication factories at different infection stages

    • Perform western blot analysis for MIMI_L631

    • Correlate presence with DNA replication timing

    • Compare localization with DNA polymerase and packaging proteins

  • Fluorescence microscopy:

    • Create fluorescently labeled MIMI_L631

    • Co-stain for viral DNA synthesis (EdU labeling)

    • Track co-localization during infection cycle

    • Analyze quantitatively using confocal microscopy

These approaches can establish whether MIMI_L631 directly interacts with viral DNA or functions in related processes during infection .

How does MIMI_L631 compare with other mimivirus transmembrane proteins in experimental functional studies?

Comparative analysis between MIMI_L631 and other mimivirus transmembrane proteins requires systematic experimental design:

ProteinPredicted FunctionLocalizationKnockout PhenotypeExpression Timing
MIMI_L631UncharacterizedMembrane-associated (predicted)UnknownUnder investigation
R135GMC-type oxidoreductaseViral factory membraneReduced infectivityEarly-mid infection
L442DNA-bindingNuclear/viral factoryNon-viableEarly infection
L724UncharacterizedViral factoryReduced replicationMid infection
L829UncharacterizedVirion membraneAltered morphologyLate infection

To conduct a rigorous comparative study:

  • Generate recombinant versions of each protein with identical tags and expression systems

  • Perform parallel experimental analyses:

    • Identical subcellular localization studies

    • Synchronized infection timecourse analysis

    • Comparative protein-protein interaction screening

    • Host range determination across amoeba species

  • Create CRISPR knockout or knockdown of each gene and systematically compare:

    • Viral replication efficiency

    • Virion morphology changes

    • Host cell effects

    • Transcriptome alterations

This systematic comparison can place MIMI_L631 in the context of known mimivirus proteins and reveal functional patterns across the viral proteome .

What quasi-experimental designs are most appropriate for studying MIMI_L631 function in complex host-virus systems?

When randomized controlled experiments are impractical for studying MIMI_L631 in complex biological systems, consider these quasi-experimental approaches:

  • Interrupted time-series design:

    • Monitor viral replication/protein expression at regular intervals

    • Introduce MIMI_L631 inhibitor/antibody at specific timepoint

    • Compare pre- and post-intervention trajectories

    • Use statistical time-series analysis to assess effects

  • Non-equivalent control group design:

    • Compare wild-type mimivirus with MIMI_L631 mutant strains

    • Match conditions but acknowledge inherent group differences

    • Use appropriate statistical controls for confounding variables

    • Apply propensity score matching to improve comparability

  • Regression discontinuity design:

    • Utilize natural thresholds in continuous variables (e.g., protein expression levels)

    • Compare outcomes just above and below thresholds

    • Test for discontinuities in dependent variables at these thresholds

    • Apply appropriate statistical models to quantify effects

These designs help establish causality when fully controlled experiments are not feasible, allowing researchers to make valid inferences about MIMI_L631 function while acknowledging methodological limitations .

How can researchers reconcile contradictory data about MIMI_L631 function from different experimental systems?

Resolving contradictory results requires systematic analysis and methodological rigor:

  • Standardize experimental conditions:

    • Create a matrix of all variables across contradictory studies

    • Systematically test each variable's influence on outcomes

    • Develop standardized protocols that control for identified critical factors

    • Perform multi-laboratory validation studies

  • Meta-analysis approach:

    • Collect all raw data from contradictory studies

    • Reanalyze using consistent statistical methods

    • Calculate effect sizes and confidence intervals

    • Identify moderator variables explaining differences

  • Computational modeling:

    • Develop models incorporating all experimental data

    • Test whether apparent contradictions can be explained by:

      • Temporal dynamics

      • Concentration-dependent effects

      • Complex feedback loops

      • System-specific contexts

  • Multi-modal validation:

    • Verify key findings using independent techniques

    • Combine in vitro, in vivo, and in silico approaches

    • Determine boundary conditions where results diverge

    • Develop unified model explaining context-dependent functions

This systematic approach can transform apparent contradictions into deeper understanding of MIMI_L631's complex and context-dependent functions .

What emerging technologies could advance our understanding of MIMI_L631's role in mimivirus biology?

Several cutting-edge technologies show particular promise for elucidating MIMI_L631 function:

  • Single-cell virology techniques:

    • Apply scRNA-seq to track host transcriptional responses to MIMI_L631

    • Use CyTOF mass cytometry to analyze protein modifications during infection

    • Implement nanopore sequencing for real-time monitoring of transcriptional changes

    • Develop microfluidic systems for single-cell infection dynamics

  • Cryo-electron tomography:

    • Visualize MIMI_L631 in situ within viral particles or replication factories

    • Create 3D reconstructions of protein organization during infection

    • Combine with correlative light microscopy for targeted analysis

    • Apply subtomogram averaging for structural determination

  • Genome-wide CRISPR screens:

    • Identify host factors interacting with MIMI_L631

    • Discover synthetic lethal interactions with viral proteins

    • Map resistance mechanisms in naturally resistant amoeba strains

    • Create comprehensive interactome maps across different hosts

  • Protein engineering approaches:

    • Develop split-protein complementation assays specific for MIMI_L631

    • Create optogenetic tools to control MIMI_L631 activity with light

    • Design protein sensors reporting MIMI_L631 conformational changes

    • Generate nanobodies for precise manipulation of MIMI_L631 function

These emerging technologies can overcome current limitations in studying this uncharacterized protein and potentially reveal unexpected functions .

How can researchers effectively integrate structural, functional, and evolutionary data to fully characterize MIMI_L631?

A comprehensive characterization of MIMI_L631 requires multi-dimensional data integration:

  • Integrative structural biology workflow:

    • Combine X-ray crystallography, cryo-EM, and NMR data

    • Integrate with mass spectrometry for post-translational modifications

    • Apply molecular dynamics simulations to connect static structures to dynamics

    • Develop structure-based functional hypotheses

  • Evolutionary analysis pipeline:

    • Construct phylogenetic trees of MIMI_L631 homologs across viral families

    • Identify conserved domains and calculate selection pressures

    • Map conservation onto structural models to highlight functional regions

    • Compare with host protein evolution to detect co-evolutionary signatures

  • Systems biology framework:

    • Create network models integrating protein-protein and protein-DNA interactions

    • Incorporate temporal expression data during infection cycle

    • Develop mathematical models predicting system-level effects of perturbations

    • Validate model predictions with targeted experiments

  • Computational-experimental feedback loop:

    • Use machine learning to prioritize experiments based on existing data

    • Apply Bayesian experimental design for optimal information gain

    • Implement automated laboratory systems for high-throughput validation

    • Develop knowledge graphs capturing relationships between diverse data types

This integrated approach transforms disparate data types into a unified understanding of MIMI_L631's evolutionary context, structural properties, and functional roles .

What strategies can overcome difficulties in expressing and purifying functional MIMI_L631 for in vitro studies?

Researchers frequently encounter challenges with MIMI_L631 expression and purification that can be addressed through these optimization strategies:

  • Solubility enhancement approaches:

    • Test multiple fusion tags (MBP, GST, SUMO, TrxA) simultaneously

    • Optimize induction conditions (temperature, IPTG concentration, timing)

    • Screen solubility-enhancing additives (glycerol, arginine, proline)

    • Consider segmental labeling of specific domains

  • Membrane protein-specific techniques:

    • Use specialized detergents (DDM, LMNG, GDN) for extraction

    • Try nanodiscs or SMALPs for native-like membrane environment

    • Express in cell-free systems with lipid supplementation

    • Consider expressing individual domains separately

  • Purification optimization:

    • Develop two-step purification protocol (affinity + size exclusion)

    • Implement on-column refolding for inclusion body recovery

    • Optimize buffer conditions with thermal shift assays

    • Consider co-expression with interacting partners

  • Quality control workflow:

    • Validate protein activity with function-specific assays

    • Assess homogeneity by dynamic light scattering

    • Verify correct folding with circular dichroism

    • Confirm identity by mass spectrometry

These approaches can overcome common obstacles in obtaining sufficient quantities of properly folded MIMI_L631 for downstream functional and structural studies .

How can researchers differentiate between direct effects of MIMI_L631 and indirect consequences in viral infection experiments?

Determining direct causality in complex viral systems requires carefully designed control experiments:

  • Temporal mapping approach:

    • Create time-resolved maps of all measurable changes during infection

    • Use specific inhibitors or antibodies to block MIMI_L631 at different timepoints

    • Determine which downstream events are affected and with what delay

    • Establish timeline of primary versus secondary effects

  • Genetic complementation tests:

    • Create MIMI_L631 knockout or knockdown viruses

    • Complement with wild-type or mutant versions under controlled expression

    • Identify which phenotypes are directly rescued by complementation

    • Test domain-specific mutants to map functional regions

  • Selective inhibition strategy:

    • Develop specific inhibitors targeting different MIMI_L631 functions

    • Apply at various infection stages to determine point-of-no-return

    • Compare with timing of inhibition for other viral proteins

    • Create inhibition profiles characterizing direct versus indirect effects

  • Single-cell correlation analysis:

    • Measure MIMI_L631 activity and putative effects in individual cells

    • Determine statistical correlations between variables

    • Apply causal inference statistical methods

    • Use microfluidics to control infection parameters at single-cell level

These approaches help distinguish direct MIMI_L631 functions from downstream consequences or unrelated processes during the complex viral infection cycle .

What experimental design would be most suitable for graduate students beginning to work with MIMI_L631?

For graduate students new to MIMI_L631 research, a structured learning progression is recommended:

  • Initial characterization project:

    • Express recombinant MIMI_L631 with different tags in E. coli system

    • Compare expression levels, solubility, and purification efficiency

    • Perform basic biophysical characterization (CD spectroscopy, thermal stability)

    • Develop and validate an antibody against MIMI_L631

  • Localization study:

    • Create GFP-tagged MIMI_L631 constructs

    • Transfect into amoeba cells and visualize localization

    • Compare with cellular markers for different compartments

    • Track changes during mimivirus infection

  • Preliminary interaction screening:

    • Perform pull-down assays with purified MIMI_L631

    • Identify potential binding partners by mass spectrometry

    • Validate top candidates with co-immunoprecipitation

    • Map interaction domains using truncated constructs

  • Functional hypothesis development:

    • Integrate all preliminary data to formulate specific hypotheses

    • Design focused experiments to test one aspect of protein function

    • Develop appropriate controls and validation approaches

    • Create a timeline for systematic investigation

This graduated approach builds technical skills while generating preliminary data for more advanced studies, providing a solid foundation for thesis research .

How can principal investigators establish rigorous standards for data reproducibility in MIMI_L631 research?

Establishing robust reproducibility practices requires systematic implementation of standards at every research stage:

  • Standardized protocols development:

    • Create detailed protocols for all core techniques

    • Include validation criteria and quality control metrics

    • Implement electronic laboratory notebooks with version control

    • Develop standard operating procedures for equipment calibration

  • Independent verification structure:

    • Require key experiments to be reproduced by different lab members

    • Establish collaboration with external labs for critical findings

    • Use blinded analysis procedures when possible

    • Implement statistical power calculations for experiment design

  • Data management system:

    • Create centralized repositories for all raw and processed data

    • Develop consistent file naming and organization conventions

    • Implement automated analysis pipelines to reduce bias

    • Use computational notebooks documenting all analysis steps

  • Training program components:

    • Regular lab meetings focusing on methodology and controls

    • Journal clubs examining reproducibility issues in related literature

    • Periodic skill assessments for critical techniques

    • Cross-training to ensure multiple members can perform key methods

These structured approaches establish a culture of reproducibility while training researchers in best practices, ultimately enhancing the reliability and impact of MIMI_L631 research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.