Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L65 (MIMI_L65)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L65; Uncharacterized protein L65
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-355
Protein Length
Full Length of Mature Protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L65
Target Protein Sequence
SIIISDIGYSDDGYNRPTGRQGTIENGDPYRITVPAGYSYTNKNVQNGNMIRLVRVNDSK
NGCWYNGSGDGWLEIRDYVGPDWRADWTVQIINPANNDNSLYYGQHFRLMNRAQVENPTF
QGPSDFASIALWGSNNTNNSVMMLLNGPLDTAKLECCKDNPIFTQPDYCANYRGTTCSGQ
CDDILSNYCAQVTTTDPKCGCLLPASFYTQNSAIGPPECIDDRCVDTNSYRKSTQCHPNC
QIVDCDININDFNGTNINKIVYEQECGSKSTPNGPNGPTPTPSNGPNGPTPVPGIPPANG
SSTSFFSRYGLWIIIAIILLIVIISAVGIYFYLR
Uniprot No.
Target Background
Database Links
KEGG: vg:9924657
Subcellular Location
Host membrane; Single-pass type I membrane protein. Virion.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
