Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682 (MIMI_L682)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type will be determined during production, we are open to developing custom tagged proteins. If you have a specific tag requirement, please inform us and we will prioritize fulfilling your request.
Synonyms
MIMI_L682; Uncharacterized protein L682
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L682
Target Protein Sequence
MGNYISFKKEFGLILVGAIIFTASYLWKDLLLEIEEKYFPKGYGLMWRSIYTILVTVILV LVAIHLKNQFGLVNKDSKDPKDKSIEFDDSPIRDGSSGTPDNSNEPTDLSVETS
Uniprot No.

Target Background

Database Links

KEGG: vg:9925331

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems yield optimal results for producing Recombinant MIMI_L682?

Based on current research protocols, E. coli represents the most commonly employed expression system for MIMI_L682 recombinant protein production . When designing expression experiments for this protein, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coli- Cost-effective
- High yield
- Established protocols
- Potential improper folding
- Lack of post-translational modifications
Insect cells- Better folding
- Some post-translational modifications
- Higher cost
- Longer production time
Mammalian cells- Native-like folding
- Complete post-translational modifications
- Highest cost
- Lower yield
- Complex protocols

For optimal expression in E. coli, the methodology should include:

  • Codon optimization based on E. coli codon usage

  • Addition of a His-tag for purification purposes

  • Expression vector selection with an appropriate promoter (T7 is commonly used)

  • Induction conditions optimization (temperature, IPTG concentration, and induction time)

What purification strategies provide highest purity for functional studies of MIMI_L682?

Given that commercially available recombinant MIMI_L682 is typically produced with a His-tag, immobilized metal affinity chromatography (IMAC) serves as the primary purification step . A comprehensive purification strategy would include:

  • Initial purification using Ni-NTA or Co-NTA columns for His-tagged proteins

  • Secondary purification through size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for removing contaminants with different charge properties

  • Quality assessment using:

    • SDS-PAGE to confirm size and purity

    • Western blotting to confirm identity

    • Mass spectrometry for accurate mass determination

For membrane-associated proteins like MIMI_L682 (suggested by its sequence), inclusion of detergents in purification buffers may be necessary to maintain protein solubility and structural integrity throughout the purification process .

What are the optimal storage conditions for maintaining stability of purified MIMI_L682?

Based on commercial storage recommendations, MIMI_L682 should be stored in a Tris-based buffer containing 50% glycerol . Recommended storage protocols include:

Storage ConditionRecommended UsageExpected Stability
4°CWorking aliquotsUp to one week
-20°CMedium-term storageSeveral months
-80°CLong-term storageSeveral years

To maximize stability, researchers should:

  • Aliquot the protein in single-use volumes to avoid freeze-thaw cycles

  • Include cryoprotectants such as glycerol (30-50%)

  • Consider adding reducing agents like DTT or β-mercaptoethanol if the protein contains cysteine residues

  • Avoid repeated freezing and thawing as noted in product specifications

What experimental designs are most effective for characterizing the function of uncharacterized viral proteins like MIMI_L682?

Characterizing uncharacterized proteins requires a systematic experimental approach. For MIMI_L682, implementing a multi-faceted experimental design would be most effective, following these methodological steps:

  • Bioinformatic analysis pipeline:

    • Sequence homology searches against characterized proteins

    • Structural prediction using AlphaFold or similar tools

    • Motif identification for potential functional domains

    • Phylogenetic analysis to identify evolutionary relationships

  • Experimental design for functional characterization:

    • Controlled manipulation of independent variables (expression levels, conditions)

    • Clear definition of dependent variables (phenotypic changes, interaction profiles)

    • Appropriate controls to account for extraneous variables

  • Structured approach to hypothesis testing:

    • Null hypothesis: MIMI_L682 has no effect on specific viral or host processes

    • Alternate hypothesis: MIMI_L682 influences specific measurable outcomes

    • Statistical analysis to determine significance of observed effects

  • Knockout/knockdown studies:

    • CRISPR-Cas9 or RNAi approaches to reduce expression

    • Phenotypic analysis of viral replication efficiency

    • Complementation studies to confirm specificity of observed effects

This systematic approach controls for confounding variables while establishing causality between protein function and observed effects .

What protein-protein interaction methods are most suitable for identifying binding partners of MIMI_L682?

Identifying protein-protein interactions for uncharacterized proteins requires employing multiple complementary techniques. For MIMI_L682, the following methodological approach is recommended:

TechniqueAdvantagesLimitationsApplicability to MIMI_L682
Yeast Two-Hybrid (Y2H)- High throughput
- In vivo interactions
- Library screening
- High false positive rate
- Requires nuclear localization
Medium - may not be ideal for membrane-associated proteins
Co-Immunoprecipitation (Co-IP)- Detects complexes in near-native conditions
- Can identify indirect interactions
- Requires antibodies
- Lower sensitivity
High - especially with tagged recombinant protein
Pull-down assays- Direct detection of physical interactions
- Compatible with mass spectrometry
- Potential for non-specific binding
- In vitro conditions
High - can use His-tagged MIMI_L682 as bait
Proximity labeling (BioID/APEX)- Detects transient interactions
- Works in native cellular context
- Requires genetic engineering
- May label proximal non-interactors
Medium - depends on expression in relevant system

As mentioned in the search results, interactions with MIMI_L682 have been detected using methods such as yeast two-hybrid, co-IP, and pull-down assays . A comprehensive approach would utilize multiple methods to validate interactions and minimize false positives.

How can structural prediction tools help guide functional studies of MIMI_L682?

In the absence of experimentally determined structures, computational prediction tools provide valuable insights for guiding functional studies of uncharacterized proteins like MIMI_L682:

  • Structure prediction methodology:

    • Employ AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Use I-TASSER or SWISS-MODEL for homology-based modeling if templates exist

    • Apply transmembrane topology prediction tools (TMHMM, Phobius) given the hydrophobic regions in MIMI_L682's sequence

  • Structure-guided experimental design:

    • Identify potential binding pockets for ligand discovery

    • Map conserved surface residues for targeted mutagenesis

    • Design truncated constructs based on domain predictions

  • Integrative approach combining prediction with experiments:

    • Use predicted structures to design experiments testing specific hypotheses

    • Validate structural features through circular dichroism or limited proteolysis

    • Iteratively refine models based on experimental data

  • Functional annotation based on structural similarities:

    • Search for structural homologs using DALI or VAST

    • Identify potential functions based on similar folding patterns

    • Design activity assays based on predicted function

This integrated approach allows researchers to move beyond sequence analysis to structure-informed functional hypotheses, significantly accelerating characterization of MIMI_L682 .

What challenges exist in developing antibodies against viral proteins like MIMI_L682?

Developing effective antibodies against viral proteins presents several methodological challenges, particularly for uncharacterized proteins like MIMI_L682:

  • Epitope selection challenges:

    • Analysis of MIMI_L682's sequence indicates potential membrane association, limiting accessible epitopes

    • Hydrophobic regions may be poorly immunogenic

    • Potential post-translational modifications might affect epitope recognition

  • Methodological approach for antibody development:

    • Epitope prediction using computational tools

    • Selection of both linear and conformational epitopes

    • Production of peptide antigens for poorly soluble regions

  • Validation strategy for antibody specificity:

    • Western blot against recombinant protein

    • Immunofluorescence in infected vs. uninfected cells

    • Competition assays with purified recombinant protein

  • Production considerations table:

Antibody TypeAdvantagesLimitationsRecommended Application
Polyclonal- Multiple epitope recognition
- Higher sensitivity
- Faster production
- Batch-to-batch variation
- Lower specificity
Initial detection, immunoprecipitation
Monoclonal- Higher specificity
- Consistent performance
- Renewable resource
- Single epitope recognition
- More time-consuming to develop
Specific applications requiring high reproducibility
Recombinant- No animals required
- Defined sequence
- Potential for engineering
- Higher cost
- Technical complexity
Applications requiring defined binding properties

Custom antibody development against MIMI_L682 would significantly advance research by enabling techniques like immunofluorescence and immunoprecipitation, which are crucial for understanding protein localization and interactions during viral infection .

How can mass spectrometry techniques be utilized to study post-translational modifications in MIMI_L682?

Post-translational modifications (PTMs) can significantly impact protein function. For MIMI_L682, a comprehensive mass spectrometry approach would include:

  • Sample preparation methodology:

    • Enrichment of recombinant protein using affinity purification

    • Digestion with multiple proteases (trypsin, chymotrypsin) to ensure complete coverage

    • Fractionation to reduce sample complexity

  • MS analysis workflow:

    • Initial intact protein MS to determine total mass and major modifications

    • Bottom-up proteomics with LC-MS/MS for PTM site mapping

    • Targeted analysis for specific modifications using neutral loss scanning or multiple reaction monitoring

  • PTM-specific enrichment strategies:

PTM TypeEnrichment MethodDetection ApproachApplication to MIMI_L682
PhosphorylationTiO₂, IMACNeutral loss of phosphateAnalysis of potential regulatory sites
GlycosylationLectin affinity, hydrazide chemistryGlycopeptide fragmentationInvestigation of potential membrane interactions
UbiquitinationK-ε-GG antibodyRemnant modification detectionStudy of potential degradation signals
AcetylationAnti-acetyl-lysine antibodyModification mass shiftsAnalysis of regulatory mechanisms
  • Differential PTM mapping:

    • Compare modifications between recombinant and native protein

    • Analyze PTM changes during viral infection cycle

    • Correlate PTMs with protein activity or localization

This comprehensive approach would reveal important functional aspects of MIMI_L682 that cannot be predicted from sequence alone, particularly regarding its regulation and interactions .

What are the most effective experimental designs for studying MIMI_L682's role in viral replication?

To elucidate MIMI_L682's role in viral replication, a systematic experimental design approach with careful control of variables is essential:

  • Experimental design framework:

    • Independent variable: MIMI_L682 expression/function

    • Dependent variable: Viral replication efficiency

    • Control variables: Temperature, host cell type, MOI

  • Knockout/knockdown experimental design:

    • CRISPR-Cas9 deletion of the gene

    • Inducible knockdown systems

    • Time-of-addition experiments with inhibitors

    • Complementation with wild-type and mutant variants

  • Between-subjects and within-subjects designs:

    • Between-subjects: Different cell lines expressing MIMI_L682 variants

    • Within-subjects: Time-course analysis of viral replication

  • Replication assay methodology:

    • Viral titer measurement through plaque assays

    • qPCR quantification of viral genome replication

    • Immunofluorescence to track virion assembly

    • Electron microscopy for morphological analysis

This experimental approach systematically controls extraneous variables while establishing causal relationships between MIMI_L682 function and viral replication outcomes, following established principles of experimental design in virology research .

How can evolutionary analyses of MIMI_L682 inform functional hypotheses?

Evolutionary analysis provides valuable context for understanding uncharacterized proteins. For MIMI_L682, a comprehensive evolutionary approach would include:

  • Phylogenetic analysis methodology:

    • Identification of homologs across viral families

    • Multiple sequence alignment with MUSCLE or MAFFT

    • Construction of phylogenetic trees using maximum likelihood methods

    • Ancestral sequence reconstruction

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify positively selected sites

    • Identification of conserved residues likely crucial for function

    • Mapping conservation patterns onto predicted structural models

  • Co-evolution analysis:

    • Identification of co-evolving residues suggesting functional interactions

    • Correlation with known interaction partners from related viruses

    • Prediction of potential binding interfaces

  • Comparative genomics approach:

Analysis TypeTools/MethodsExpected InsightsApplication to MIMI_L682
Synteny analysisGenome context comparisonGene neighborhood conservationIdentification of functionally related genes
Domain architectureInterProScan, SMARTModular composition and evolutionDetection of cryptic functional domains
Horizontal gene transferReconciliation methodsAcquisition eventsOrigins of MIMI_L682 in viral evolution
Presence/absence patternsComparative genomicsEssentiality across viral speciesDetermination of core vs. accessory functions

This evolutionary perspective can highlight conserved features that may not be apparent from sequence analysis alone, guiding hypothesis generation about MIMI_L682's functional role .

What are the best approaches for validating recombinant MIMI_L682 activity in functional assays?

Validating recombinant protein activity is crucial before conducting functional studies. For MIMI_L682, a comprehensive validation approach includes:

  • Structural integrity validation:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Thermal shift assays to assess stability

    • Dynamic light scattering to detect aggregation

  • Functional validation methodologies:

    • Binding assays with predicted interaction partners

    • Activity assays based on bioinformatic predictions

    • Cell-based assays measuring phenotypic effects

  • Control strategy for validation experiments:

    • Positive controls: Known functional viral proteins

    • Negative controls: Heat-denatured protein, irrelevant proteins

    • Internal controls: Multiple batches of purified protein

  • Validation checklist for recombinant MIMI_L682:

    • Confirm protein identity via mass spectrometry

    • Verify size and purity through SDS-PAGE

    • Assess oligomeric state through size exclusion chromatography

    • Test functionality in appropriate biological contexts

This methodical validation approach ensures that subsequent experimental results are attributable to the authentic activity of MIMI_L682 rather than artifacts from the recombinant production process .

How should researchers design experiments to investigate MIMI_L682's potential membrane association?

Based on MIMI_L682's amino acid sequence containing hydrophobic regions , investigating its potential membrane association requires specialized experimental approaches:

  • Computational prediction foundation:

    • Transmembrane domain prediction (TMHMM, TMpred)

    • Hydrophobicity analysis (Kyte-Doolittle plots)

    • Signal peptide prediction (SignalP)

    • Membrane interaction motif identification

  • Biochemical characterization methodology:

    • Membrane fractionation assays

    • Protease protection assays

    • Carbonate extraction to distinguish peripheral vs. integral association

    • Detergent solubility profiling

  • Imaging approaches:

    • Immunofluorescence microscopy with subcellular markers

    • FRET analysis with known membrane proteins

    • Electron microscopy with immunogold labeling

  • Experimental design considerations:

TechniquePrimary Question AddressedRequired ControlsPotential Pitfalls
Membrane flotationAssociation with membranesSoluble and integral membrane protein controlsAggregation can mimic membrane association
Fluorescent protein taggingSubcellular localizationMultiple tag positions, tag-only controlsTags may disrupt targeting
Liposome binding assaysDirect lipid interactionLipid composition variants, protein concentration seriesNon-specific hydrophobic interactions
Bimolecular fluorescence complementationIn vivo membrane targetingMultiple fusion constructs, non-interacting controlsArtifactual complementation

This systematic approach helps determine whether MIMI_L682's hydrophobic regions represent functional membrane-interaction domains or serve other structural purposes, providing key insights into its cellular localization and function .

What research gaps remain in our understanding of MIMI_L682 and how might they be addressed?

Current literature indicates significant knowledge gaps regarding MIMI_L682, as evidenced by its "uncharacterized" status and incomplete pathway and function information . Key research priorities include:

  • Functional characterization gaps:

    • Unknown biological function during viral infection

    • Undetermined subcellular localization

    • Unidentified interaction partners

    • Unclear temporal expression pattern

  • Methodological approaches to address gaps:

    • Temporal transcriptomics/proteomics during viral infection

    • Proximity labeling to identify interaction networks

    • Cryo-EM structural studies

    • Host response analysis following MIMI_L682 expression

  • Integrated research strategy:

    • Combine computational predictions with experimental validation

    • Apply systems biology approaches to place MIMI_L682 in context

    • Develop mimivirus genetic manipulation systems

    • Create MIMI_L682-specific research tools (antibodies, assays)

  • Research priority matrix:

Research QuestionMethodological ApproachExpected ImpactTechnical Challenges
Function in viral lifecycleGene deletion, complementationUnderstanding viral requirementsLimited mimivirus genetic tools
Host interaction targetsInteractome analysisIdentifying host pathways affectedEnsuring physiological relevance
Structure-function relationshipsMutagenesis of conserved residuesMechanistic insightsIdentifying relevant assays
Role in viral evolutionComparative genomicsEvolutionary constraints and adaptationsLimited sequence data for distant homologs

Addressing these gaps would transform MIMI_L682 from an uncharacterized protein to a well-understood component of mimivirus biology, potentially revealing new insights into large DNA virus replication mechanisms .

How can emerging technologies advance our understanding of proteins like MIMI_L682?

Emerging technologies offer new opportunities for characterizing uncharacterized proteins like MIMI_L682:

  • AI and machine learning applications:

    • AlphaFold2 and similar tools for structure prediction

    • Deep learning for function prediction from sequence

    • Network analysis to predict functional associations

    • Automated literature mining for hypothesis generation

  • Advanced imaging technologies:

    • Super-resolution microscopy for precise localization

    • Correlative light and electron microscopy for structural context

    • Live-cell imaging with minimal tags

    • Label-free imaging techniques

  • Next-generation functional genomics:

    • CRISPR interference/activation for functional screening

    • Single-cell analysis of host response to viral proteins

    • Perturb-seq for high-throughput functional studies

    • Nanopore direct RNA sequencing for viral transcriptomics

  • Methodological innovations table:

TechnologyApplication to MIMI_L682Advantages Over Traditional MethodsImplementation Considerations
Cryo-electron tomographyVisualization in infected cellsNative context, no crystallization neededTechnical complexity, specialized equipment
AlphaFold-MultimerInteraction modelingPrediction of complex structuresValidation with experimental data
Nanobodies/synthetic antibodiesSpecific detectionSmaller size, better penetrationDevelopment time, specificity validation
Spatial transcriptomicsLocalized host responseCellular context of effectsResolution limitations, cost

These emerging technologies can overcome limitations of traditional approaches, accelerating our understanding of challenging proteins like MIMI_L682 and revealing new aspects of mimivirus biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.