Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L68 (MIMI_L68)

Shipped with Ice Packs
In Stock

Description

Production and Handling

MIMI_L68 is commercially available in recombinant form, with variations in expression systems and storage conditions:

Production Methods

VendorExpression HostSourceTagPrice
CBM Mammalian cellsQ5UPE7N/A$1,589.00/50 µg
Cusabio BaculovirusQ5UPE7N/A$1,589.00/50 µg
Creative BioMart E. coliHis-taggedHisNot listed

Research Context and Functional Insights

While MIMI_L68 remains uncharacterized, its association with APMV—a virus with a complex proteome—suggests potential roles in:

  • Viral Replication: APMV encodes machinery for DNA replication, transcription, and translation, including enzymes like aminoacyl-tRNA synthetases and nucleotide diphosphate kinases .

  • Structural or Regulatory Functions: Proteins like L442 (involved in DNA packaging) and R135 (oxidoreductase) have been implicated in APMV infection . MIMI_L68 may interact with such proteins or contribute to capsid assembly.

  • Host Interaction: Mimivirus proteins often target host pathways; for example, lipases and phosphoesterases aid membrane disruption .

Key Research Gaps

  • Functional Studies: No direct experimental evidence links MIMI_L68 to specific processes.

  • Structural Analysis: Tertiary structure predictions (e.g., via Phyre2) could elucidate domain homologies .

  • Interactome Mapping: Co-immunoprecipitation or mass spectrometry studies are needed to identify binding partners .

Applications in Research and Diagnostics

MIMI_L68 is primarily used in:

  • ELISA Kits: For detecting anti-APMV antibodies or protein interactions .

  • Viral Biology Studies: To investigate APMV’s unique genetic and structural features, such as its lipid membranes and transcriptional machinery .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L68; Uncharacterized protein L68
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L68
Target Protein Sequence
MDYFSIIKITMITEIYFQYVIYILCFGVLLLLKSESDRLLWLHLVSILVGLIANYEMKFN VLFAMFHSAVHNLWPFLKNTGYDNTEKSVYDVICHTIMVVICYHQICYTENAVTNNYYTF HLFSVMIIIGALFNCVVSGKAIGSNDRFLHSLFEYTTIFQALSTGYWVATMLWYHHLDNI HFYSHWIIWIGLMTINWFVYKFYPNLVGISMRYKYVEAVFIVCTWYSGIISSPLIKYINV Y
Uniprot No.

Target Background

Database Links

KEGG: vg:9924662

Protein Families
Mimivirus L68/R809 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Acanthamoeba polyphaga mimivirus and how does protein L68 fit into its genome?

Acanthamoeba polyphaga mimivirus is classified as the first giant virus ever described, featuring an exceptionally large 1.2-Mb genome that encodes approximately 979 proteins, including multiple components involved in translational machinery . The uncharacterized protein L68 (MIMI_L68) represents one of these numerous proteins encoded within the mimivirus genome. While many proteins in the mimivirus have known functions, MIMI_L68 remains categorized as "uncharacterized," indicating that its precise biological role and functional mechanisms have not yet been conclusively determined through experimental validation. This classification parallels challenges seen with many human proteins that also remain uncharacterized despite advances in proteomic technologies .

What expression systems are most effective for producing recombinant MIMI_L68?

For recombinant expression of MIMI_L68, researchers typically employ prokaryotic expression systems, particularly E. coli-based platforms that have been optimized for viral protein production. The methodological approach involves:

  • Gene synthesis or PCR amplification of the MIMI_L68 coding sequence (CDS) from viral DNA

  • Cloning into an appropriate expression vector with an affinity tag (the specific tag is determined during the production process)

  • Transformation into a compatible E. coli strain (commonly BL21(DE3) or derivatives)

  • Induction of protein expression using IPTG or auto-induction media

  • Cell lysis and protein purification through affinity chromatography

  • Buffer optimization with Tris-based formulations supplemented with 50% glycerol for stability

The recombinant protein is typically stored in Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein to maintain its stability and functional integrity. For short-term usage, working aliquots can be maintained at 4°C for up to one week, while long-term storage requires temperatures of -20°C or -80°C to prevent degradation .

How should researchers handle and store recombinant MIMI_L68 to maintain its stability?

Optimal handling and storage protocols for recombinant MIMI_L68 are essential for maintaining protein integrity and experimental reproducibility. The recommended methodological approach includes:

  • Storage buffer formulation: Utilize a Tris-based buffer system containing 50% glycerol that has been specifically optimized for MIMI_L68 stability

  • Temperature management: Store the protein at -20°C for regular usage, or at -80°C for extended preservation periods

  • Aliquoting strategy: Prepare multiple small-volume working aliquots immediately after purification to minimize freeze-thaw cycles

  • Working conditions: Maintain working aliquots at 4°C for no longer than one week

  • Freeze-thaw considerations: Avoid repeated freezing and thawing cycles as they significantly compromise protein stability

When designing experiments, researchers should account for potential activity loss during storage and handling by including appropriate controls and standardization procedures. For applications requiring extended experimental timeframes, fresh aliquots should be utilized at regular intervals to ensure consistent protein quality throughout the research process.

What experimental approaches are most effective for elucidating the function of uncharacterized proteins like MIMI_L68?

Elucidating the function of uncharacterized viral proteins such as MIMI_L68 requires a multi-faceted experimental approach. Based on methodologies successful with other mimivirus proteins, researchers should consider implementing:

  • Comparative genomics and proteomics: Analysis of MIMI_L68 sequence conservation across different mimiviruses and potential homologs in other viral or host systems can provide initial functional insights

  • Gene silencing studies: siRNA-based silencing, as successfully employed with mimivirus protein R458, can reveal phenotypic consequences of MIMI_L68 knockdown on viral fitness and protein expression patterns

  • Protein-protein interaction mapping: Techniques such as:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling methods (BioID or APEX)

    • Crosslinking mass spectrometry (XL-MS)

  • Temporal expression analysis: RNA-seq and proteomic profiling across different infection stages to determine when MIMI_L68 is expressed, which may indicate its role in the viral lifecycle

  • Structural biology approaches: X-ray crystallography, cryo-EM, or NMR spectroscopy to determine protein structure and infer function based on structural features

  • Host-response studies: Analysis of host cell responses to recombinant MIMI_L68 expression or during infection with mimivirus variants with altered MIMI_L68 expression

When implementing such approaches, researchers should design appropriate controls and comparative analyses. For example, a two-dimensional difference-in-gel electrophoresis (2D-DIGE) approach similar to that used for studying R458 could reveal deregulation patterns of other viral proteins in response to MIMI_L68 manipulation .

How can researchers design experiments to investigate potential interactions between MIMI_L68 and host cell proteins?

Investigating protein-protein interactions between viral proteins like MIMI_L68 and host cellular components requires a systematic experimental design that accounts for both direct and indirect interactions. The following methodological framework is recommended:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged recombinant MIMI_L68 in Acanthamoeba cells

    • Perform pull-down experiments under varying conditions (different detergents, salt concentrations)

    • Identify binding partners through LC-MS/MS

    • Validate interactions through reciprocal pull-downs

  • Proximity-based labeling techniques:

    • Construct fusion proteins of MIMI_L68 with BioID2 or APEX2

    • Express in host cells and activate labeling during different infection stages

    • Purify biotinylated proteins and identify by mass spectrometry

    • Create interaction networks based on temporal and spatial proximity data

  • Fluorescence microscopy approaches:

    • Perform co-localization studies with fluorescently tagged MIMI_L68 and potential host partners

    • Implement Förster Resonance Energy Transfer (FRET) to detect direct protein interactions

    • Utilize split fluorescent protein complementation assays to confirm specific interactions

  • Functional validation studies:

    • Design competition assays with potential binding domains

    • Perform mutagenesis of key residues and assess impact on interactions

    • Utilize CRISPR-Cas9 to modify host factors and evaluate effects on MIMI_L68 function

When designing these experiments, researchers should consider the context of viral infection, as interactions may be dynamic and dependent on specific stages of the viral lifecycle. Additionally, control experiments using other mimivirus proteins with known functions (such as R458) can provide valuable comparative insights .

What analytical approaches should be employed to determine if MIMI_L68 plays a role in mimivirus translation regulation similar to the R458 protein?

To investigate whether MIMI_L68 has a function in translation regulation similar to the characterized R458 protein, researchers should implement a comprehensive analytical framework that combines genetic, biochemical, and systems biology approaches:

  • Genetic manipulation and phenotypic analysis:

    • Develop a gene silencing system using siRNA targeting MIMI_L68, similar to methods used for R458

    • Compare viral fitness metrics (growth rate, particle production) between silenced and wild-type mimivirus

    • Quantify impacts on viral lifecycle progression through time-course experiments

  • Comparative proteomics:

    • Implement two-dimensional difference-in-gel electrophoresis (2D-DIGE) to identify proteins with altered expression in response to MIMI_L68 silencing

    • Categorize affected proteins according to functional classes (structural components, transcriptional machinery, etc.)

    • Determine whether proteins affected by MIMI_L68 silencing overlap with those affected by R458 silencing

  • RNA-binding assays:

    • Perform RNA immunoprecipitation followed by sequencing (RIP-seq) to identify RNA sequences bound by MIMI_L68

    • Conduct in vitro binding assays with synthetic RNA structures to determine specificity

    • Employ CLIP-seq (crosslinking immunoprecipitation) to map binding sites with nucleotide resolution

  • Translational efficiency measurements:

    • Utilize polysome profiling in the presence and absence of MIMI_L68

    • Implement ribosome profiling to assess translational impact genome-wide

    • Develop reporter assays with viral 5' UTRs to assess specific translational effects

The analysis should integrate findings across these different approaches to construct a comprehensive model of MIMI_L68 function. Particular attention should be paid to whether MIMI_L68, like R458, affects the expression of proteins associated with late-phase genes in the viral cycle .

How can researchers investigate the structural features of MIMI_L68 and their relationship to protein function?

Investigating the structure-function relationship of MIMI_L68 requires a multi-technique approach that combines computational prediction, experimental structure determination, and functional validation. The following methodological framework is recommended:

  • Computational structure prediction and analysis:

    • Implement modern deep learning methods (AlphaFold2, RoseTTAFold) to predict MIMI_L68 structure

    • Conduct comparative modeling using any identified structural homologs

    • Analyze sequence conservation patterns and map them onto the predicted structure

    • Identify potential functional domains through motif scanning and structural alignment

  • Experimental structure determination:

    • Express and purify domains of MIMI_L68 for crystallization trials

    • Attempt solution NMR for smaller domains or fragments

    • Consider cryo-electron microscopy for full-length protein or complexes

    • Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

  • Functional mapping through mutagenesis:

    • Design alanine-scanning mutagenesis across predicted functional regions

    • Create chimeric constructs with homologous domains from related viruses

    • Develop truncation variants to isolate functional domains

    • Test mutants in both biochemical assays and infection models

  • Interaction surface identification:

    • Perform cross-linking mass spectrometry to identify interaction interfaces

    • Implement epitope mapping using antibody fragments or peptide arrays

    • Utilize molecular dynamics simulations to predict conformational changes upon binding

Researchers should integrate structural data with the temporal expression patterns of MIMI_L68 during infection, as proteins expressed during different viral lifecycle phases often have distinct structural features related to their specific functions in virion assembly, genome replication, or host interaction .

What are the implications of studying MIMI_L68 for understanding the evolution of giant viruses and their uncharacterized proteomes?

Studying uncharacterized proteins like MIMI_L68 has significant implications for understanding the evolutionary history and functional complexity of giant viruses. A comprehensive research approach should address:

The insights gained from studying MIMI_L68 can serve as a model for approaches to characterizing the substantial portion of mimivirus proteins that remain functionally undefined, potentially revealing new paradigms in virus-host interactions and viral complexity evolution .

What controls should be included when designing experiments to characterize the function of MIMI_L68?

Designing rigorous experiments to characterize MIMI_L68 requires careful consideration of appropriate controls to ensure valid interpretation of results. The following methodological framework for controls should be implemented:

  • For gene silencing experiments:

    • Non-targeting siRNA controls with similar GC content to assess off-target effects

    • siRNAs targeting known mimivirus genes (e.g., R458) as positive controls

    • Multiple independent siRNAs targeting different regions of MIMI_L68 to confirm specificity

    • Dose-response assessments to determine optimal silencing conditions

  • For protein expression and purification:

    • Empty vector expression controls processed identically to MIMI_L68 samples

    • Expression of a known mimivirus protein as a positive control for system validation

    • Confirmation of protein identity through Western blotting and mass spectrometry

    • Quality control through size exclusion chromatography and activity assays

  • For functional characterization assays:

    • Heat-inactivated MIMI_L68 to control for non-specific effects

    • Mutated versions of MIMI_L68 in key predicted functional domains

    • Time-matched mock infections when studying viral lifecycle effects

    • Host cells with varying susceptibility to mimivirus infection

  • For host-interaction studies:

    • Pull-down experiments with unrelated viral or bacterial proteins

    • Competition assays with unlabeled protein to confirm specificity

    • Reciprocal tagging approaches to validate interaction directionality

    • Controlled cellular fractionation to confirm subcellular localization

When analyzing data from these experiments, researchers should employ appropriate statistical approaches that account for biological replicates and technical variation. Experimental designs should adhere to principles outlined by Campbell and Stanley regarding control groups and validity of inferences, avoiding one-shot case studies that lack proper comparative analysis .

How can researchers develop a robust experimental strategy to test hypotheses about MIMI_L68 function based on preliminary bioinformatic predictions?

Developing a robust experimental strategy to validate bioinformatic predictions about MIMI_L68 function requires a systematic approach that bridges computational hypotheses with empirical validation. The following methodological framework is recommended:

  • Hypothesis formulation and refinement:

    • Generate multiple competing hypotheses based on different computational predictions

    • Rank hypotheses according to supporting evidence strength

    • Design experiments that can simultaneously test multiple hypotheses

    • Create a decision tree for subsequent experiments based on initial results

  • Experimental design principles:

    • Implement quasi-experimental designs with appropriate control groups

    • Ensure adequate statistical power through proper sample sizing

    • Include both positive and negative controls for each experimental approach

    • Design experiments that can provide conclusive rather than merely suggestive evidence

  • Phased validation approach:

PhaseExperimental ApproachExpected OutcomeNext Steps
1In silico validation (alternative algorithms and databases)Consensus predictionsProceed to biochemical validation
2Biochemical validation (binding assays, activity tests)Confirmation of predicted molecular activitiesProceed to cellular validation
3Cellular validation (expression in host cells)Confirmation of cellular effectsProceed to infection model
4Infection model validationConfirmation of role in viral lifecycleDetailed mechanistic studies
  • Integration of multiple methodologies:

    • Combine genetic approaches (gene silencing, CRISPR) with biochemical methods

    • Utilize both in vitro and in vivo systems to validate predictions

    • Employ both targeted and unbiased (omics) approaches to capture unexpected functions

    • Integrate structural studies with functional analyses to link structure to function

This experimental strategy should be designed to not only test the primary hypothesis but also reveal unexpected functions and interactions. The approach should be sufficiently flexible to adapt based on emerging data, while maintaining rigorous controls and validation steps throughout the process.

What are the most effective assays for measuring the impact of MIMI_L68 on mimivirus replication and host cell biology?

To comprehensively assess the impact of MIMI_L68 on mimivirus replication and host cell biology, researchers should implement a multi-faceted assay strategy that captures both viral and host parameters across the infection cycle:

  • Viral replication and fitness assays:

    • Plaque formation assay to quantify infectious virus production and assess cytopathic effects

    • qPCR-based viral DNA quantification to measure genome replication kinetics

    • Single-step and multi-step growth curves to determine replication efficiency

    • Electron microscopy to assess virion morphology and intracytoplasmic viral factory formation

  • Host cell response measurements:

    • Cell viability and cytotoxicity assays (MTT, LDH release) to quantify host cell damage

    • Flow cytometry to assess cell cycle progression and apoptosis induction

    • Transcriptomic profiling of host response genes during infection

    • Metabolomic analysis to identify altered metabolic pathways in infected cells

  • Molecular interaction assays:

    • Chromatin immunoprecipitation (ChIP) to identify potential DNA interactions

    • RNA immunoprecipitation (RIP) to detect RNA binding activity

    • Co-immunoprecipitation followed by mass spectrometry to identify protein interactions

    • FRET or BRET assays to confirm direct protein-protein interactions in living cells

  • Comparative experimental designs:

    • Wild-type virus versus MIMI_L68-silenced virus infections

    • Infections in the presence of specific inhibitors of predicted pathways

    • Time-course experiments to capture dynamic changes across the infection cycle

    • Cross-species host cell infections to assess host-range determinants

When implementing these assays, researchers should establish clear metrics for effect size determination and employ appropriate statistical methods to account for biological variability. The experimental approach should also consider the potential impact of virophages, which can affect mimivirus replication and may interact with MIMI_L68 directly or indirectly .

What statistical approaches are most appropriate for analyzing complex datasets generated from MIMI_L68 functional studies?

Analyzing complex datasets from MIMI_L68 functional studies requires sophisticated statistical approaches that account for multiple variables, time-dependency, and potential interactions. The following methodological framework is recommended:

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures to minimize bias

    • Inclusion of technical and biological replicates to assess variability

    • Implementation of factorial designs to assess interaction effects

  • Appropriate statistical methods by data type:

Data TypeRecommended Analysis ApproachesValidation Methods
Time-course expression dataMixed-effects models, functional data analysisCross-validation, residual analysis
Proteomics dataANOVA-based methods with FDR correction, GSEAPermutation testing, bootstrap resampling
Interaction networksGraph theory metrics, cluster analysisNetwork perturbation, topology analysis
Phenotypic measurementsMultivariate regression, survival analysisHoldout validation, prediction accuracy
  • Advanced analytical approaches:

    • Machine learning algorithms for pattern recognition in complex datasets

    • Bayesian inference methods to incorporate prior knowledge

    • Dimensionality reduction techniques (PCA, t-SNE) for visualization

    • Network-based approaches for integrating multi-omics data

  • Reproducibility and validation considerations:

    • Implementation of cross-validation procedures

    • Confirmation of key findings using orthogonal methods

    • Sensitivity analysis to assess robustness to parameter changes

    • Transparent reporting of all statistical procedures and results

When interpreting results, researchers should consider the unique characteristics of viral systems, including the rapid evolution rates, the presence of confounding factors such as virophages , and the complex interplay between viral and host proteins. Statistical significance should be complemented by assessments of biological significance and effect size to ensure meaningful interpretation of results.

How should researchers interpret apparently contradictory results when studying uncharacterized proteins like MIMI_L68?

Interpreting contradictory results is a common challenge when studying uncharacterized proteins like MIMI_L68. Researchers should implement a systematic approach to resolve these contradictions through careful methodological analysis:

  • Source analysis of contradictions:

    • Methodological differences between studies (expression systems, purification methods)

    • Variations in experimental conditions (pH, temperature, buffer composition)

    • Different temporal contexts (early vs. late infection stages)

    • Distinct cellular contexts or host species

  • Resolution strategies:

Type of ContradictionInvestigation ApproachResolution Method
Functional assignment conflictsSide-by-side comparison using identical conditionsIdentify context-dependent functions
Localization discrepanciesMultiple tagging strategies and microscopy methodsDetermine dynamic localization patterns
Interaction partner disagreementsValidation with reciprocal approachesMap condition-specific interaction networks
Phenotypic effect variationsStandardized phenotypic assays with controlsEstablish dose-response relationships
  • Integrative approaches to contradiction resolution:

    • Develop comprehensive models that accommodate seemingly contradictory results

    • Design experiments specifically to test competing hypotheses

    • Implement meta-analysis techniques when multiple studies are available

    • Utilize Bayesian frameworks to update hypotheses based on accumulated evidence

  • Reporting and transparency considerations:

    • Clearly document all conditions that might influence outcomes

    • Report both positive and negative results to avoid publication bias

    • Acknowledge limitations and potential confounding factors

    • Present alternative interpretations when conclusive evidence is lacking

What bioinformatic tools and databases are most valuable for comparative analysis of MIMI_L68 with other uncharacterized proteins?

For comparative analysis of MIMI_L68 with other uncharacterized proteins, researchers should utilize a comprehensive suite of bioinformatic tools and databases that enable detection of subtle relationships and functional inferences:

  • Sequence-based analysis tools:

    • PSI-BLAST and HHpred for sensitive homology detection

    • HMMER for profile-based searches across diverse sequence databases

    • InterProScan for integrated domain and motif identification

    • MEME Suite for de novo motif discovery in related sequences

  • Structure-based analysis resources:

    • AlphaFold DB and RoseTTAFold for structural prediction

    • Dali and TM-align for structural similarity searches

    • PDBeFold for identification of structural homologs

    • ConSurf for mapping evolutionary conservation onto structures

  • Specialized viral and protein databases:

DatabaseContentApplication for MIMI_L68 Analysis
UniProt KBComprehensive protein informationAccessing annotation for Q5UPE7 and related proteins
ViralZoneVirus taxonomy and molecular dataContextualizing MIMI_L68 within viral proteomes
GiantVirus DatabaseGiant virus genomicsComparative analysis across Mimiviridae
ProteomeHDProtein co-regulation dataFunctional inference through guilt-by-association
  • Integrated analysis platforms:

    • STRING for protein-protein interaction network analysis

    • Reactome for pathway mapping and functional context

    • DAVID and g:Profiler for functional enrichment analysis

    • Cytoscape for network visualization and analysis

  • Specialized tools for uncharacterized protein analysis:

    • FunFam for functionally coherent protein family classification

    • COFACTOR for integrated function prediction

    • DeepFRI for deep learning-based function prediction

    • SIFTER for phylogenomics-based function prediction

What emerging technologies hold promise for accelerating functional characterization of uncharacterized proteins like MIMI_L68?

Several cutting-edge technologies are poised to revolutionize the functional characterization of uncharacterized proteins like MIMI_L68, offering unprecedented insights into their biological roles and mechanisms:

  • Advanced structural biology approaches:

    • Cryo-electron tomography for visualizing proteins in their native cellular context

    • Integrative structural biology combining multiple experimental data types

    • Time-resolved structural methods to capture conformational dynamics

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

  • Next-generation functional genomics:

    • CRISPR interference/activation systems for precise gene expression modulation

    • Single-cell multi-omics for capturing cellular heterogeneity during infection

    • Optical genetic tools for spatiotemporal control of protein function

    • Synthetic genomics approaches for minimal genome construction and function testing

  • Advanced imaging technologies:

    • Super-resolution microscopy techniques for nanoscale visualization

    • Live-cell protein tracking with photoconvertible fluorescent proteins

    • Correlative light and electron microscopy (CLEM) for structural-functional integration

    • Label-free imaging modalities for non-invasive monitoring

  • Computational and AI-based methods:

    • Deep learning approaches for function prediction from sequence and structure

    • Molecular dynamics simulations with enhanced sampling for conformational analysis

    • Network-based function prediction utilizing multi-omics data integration

    • Automated hypothesis generation and experimental design optimization

  • High-throughput protein characterization platforms:

    • Massively parallel activity-based protein profiling

    • Microfluidic approaches for single-molecule enzymology

    • Protein interaction mapping using proximity labeling at proteome scale

    • Deep mutational scanning to comprehensively map sequence-function relationships

The integration of these technologies within a coherent experimental framework represents the most promising approach for elucidating the function of MIMI_L68 and similar uncharacterized proteins. Researchers should consider adopting multi-disciplinary collaborations to leverage these diverse technological platforms for comprehensive functional characterization .

How might research on MIMI_L68 contribute to broader understanding of mimivirus-host interactions and viral evolution?

Research on MIMI_L68 has significant potential to advance our understanding of mimivirus-host interactions and viral evolution through several interconnected research avenues:

  • Evolutionary perspectives:

    • Investigating whether MIMI_L68 represents a horizontally acquired gene or ancestral viral component

    • Analyzing selection pressures on MIMI_L68 across different mimivirus lineages

    • Examining MIMI_L68 conservation across the three major groups of Mimiviridae (A, B, and C)

    • Exploring potential homologs in other giant virus families to trace deep evolutionary relationships

  • Host interaction dynamics:

    • Determining if MIMI_L68 participates in host immune evasion mechanisms

    • Investigating potential mimicry of host proteins by MIMI_L68

    • Assessing whether MIMI_L68 contributes to host range determination

    • Examining interactions with host translation machinery similar to other mimivirus proteins

  • Viral lifecycle integration:

    • Establishing where MIMI_L68 fits in the temporal gene expression pattern (early, intermediate, or late)

    • Determining its role in viral factory formation or virion assembly

    • Investigating potential interactions with other viral proteins in functional complexes

    • Assessing if MIMI_L68 participates in viral-host membrane interactions

  • Virophage interactions:

    • Exploring whether MIMI_L68 plays a role in susceptibility or resistance to virophage infection

    • Investigating potential interactions between MIMI_L68 and virophage proteins

    • Examining if MIMI_L68 participates in horizontal gene transfer facilitated by virophages

    • Determining if MIMI_L68 expression is affected by virophage co-infection

These research directions collectively contribute to understanding the complexity of giant virus biology and their evolutionary relationships with hosts and other viruses. Insights gained from MIMI_L68 characterization may serve as a model for approaching the substantial fraction of uncharacterized proteins in mimivirus genomes, potentially revealing novel mechanisms of virus-host interaction and adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.