Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L778 (MIMI_L778)

Shipped with Ice Packs
In Stock

Description

General Information

MIMI_L778 is a protein that is found in Acanthamoeba polyphaga Mimivirus . The precise function of MIMI_L778 has not been fully elucidated; it is currently annotated as an uncharacterized protein . Research indicates that several uncharacterized proteins, including MIMI_L778, are possibly involved in the generation of infectious Mimivirus virions within Acanthamoeba castellanii .

Role in Viral Infection

Studies indicate the importance of certain uncharacterized proteins in the life cycle of Mimivirus . Specifically, research involving the transfection of mimivirus DNA into A. castellanii revealed that proteins L442, L724, L829, and R387, along with GMC-type oxidoreductase R135, are needed for the generation of infectious APMV virions .

To explore the role of these proteins, researchers used proteinase K to digest proteins associated with APMV DNA extracts . SDS-PAGE analysis revealed five putative protein bands, and mass spectrometry identified one of these bands as the uncharacterized protein L442 . Further analysis identified uncharacterized protein R387, L724, and L829 . The study suggests that these proteins, though uncharacterized, play a vital role in the viral life cycle .

Protein Structure

Proteins have four levels of structure: primary, secondary, tertiary, and quaternary .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in your order notes if you have a specific requirement. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
MIMI_L778; Uncharacterized protein L778
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L778
Target Protein Sequence
MSAIRYGDNVFITLPRLSTPMIFNGLVPHYTKPNQYEYVPILSSGSIANGDSYIIEPINI NNSNTALNPQSVFRLKQVSQNKYLYDNNGIVYLGNDTDNKANWSLKPVNLNATTIDYNQE FRLVNQGTGNNAVFSTINNVTMITSKYNDTTNNSIFKFLKGPFTYAQSQCCQGNILYTRP NMCGIYKQGSSVCHTIPSSQSNYPSYTTSMVGSTQSTTPVGSNPPTHRSIDKWYIIGGIF WVIVLIILVIFIIWKLK
Uniprot No.

Target Background

Database Links

KEGG: vg:9925438

Subcellular Location
Host membrane; Single-pass membrane protein. Virion.

Q&A

What is MIMI_L778 and where is it found in the Mimivirus genome?

MIMI_L778 is an uncharacterized protein encoded by the Acanthamoeba polyphaga mimivirus genome. It is identified by the UniProt accession number Q5UPR2 and is encoded by the MIMI_L778 gene locus . The protein consists of 257 amino acids and is part of the complex mimiviral proteome. Unlike some better-characterized mimiviral proteins such as gp275 (encoded by the R252 gene) which has been identified as an MC1-like architectural protein involved in DNA condensation, the specific function of MIMI_L778 remains to be elucidated .

The MIMI_L778 gene is located within the Mimivirus genome, which spans approximately 1.2 million base pairs and contains around 1,000 protein-coding genes. Based on comparative analyses with other giant viruses, genes in this region often encode proteins involved in virus-host interactions or viral particle assembly, though this remains to be confirmed specifically for MIMI_L778.

How does MIMI_L778 compare to other characterized mimiviral proteins?

MIMI_L778 differs significantly from better-characterized mimiviral proteins like gp275. While gp275 has been identified as an MC1-like architectural protein involved in DNA condensation and genome packaging, with demonstrated DNA-binding and bending capabilities, MIMI_L778 lacks the characteristic MC1 domain and associated DNA-binding motifs found in gp275 .

FeatureMIMI_L778gp275 (R252)
FunctionUncharacterizedDNA architectural protein
DomainNo clearly identified domainsMC1-like domain
DNA bindingUnknownConfirmed
Essential for viral replicationUnknownYes (based on knockout studies)
Virion localizationUnknownPresent in virion (confirmed by mass spectrometry)
Oligomeric stateUnknownOligomeric

This comparison highlights the significant gaps in our understanding of MIMI_L778 compared to some other mimiviral proteins, underscoring the need for focused experimental studies.

How should I design expression systems for recombinant MIMI_L778 production?

When designing expression systems for recombinant MIMI_L778, consider the following methodological approach:

  • Expression vector selection: For initial characterization, use a vector system that provides:

    • Strong, inducible promoter (such as T7 or tac)

    • Fusion tags for purification and detection (His6, GST, or MBP)

    • Appropriate antibiotic resistance markers

  • Host selection considerations:

    • E. coli BL21(DE3) strains for standard expression

    • E. coli Rosetta or Origami strains if codon bias or disulfide bond formation is problematic

    • Consider eukaryotic expression systems (insect or mammalian cells) if post-translational modifications are suspected to be important

  • Expression optimization protocol:

    ParameterTest RangeConsiderations
    Temperature16-37°CLower temperatures may improve folding
    Induction time3-24 hoursMonitor expression at different timepoints
    Inducer concentration0.1-1.0 mM IPTGTitrate to balance yield and toxicity
    Media compositionLB, TB, auto-inductionRich media may improve yield
  • Solubility enhancement strategies:

    • Co-expression with chaperones if initial expression yields insoluble protein

    • Addition of solubility tags (SUMO, MBP, Trx)

    • Use of detergents for membrane-associated regions (based on the hydrophobic C-terminus)

This methodological approach follows the general experimental design principles of systematically testing variables and controlling for confounding factors to determine optimal conditions .

How can I design knockout experiments to study MIMI_L778 function?

To design knockout experiments for MIMI_L778 similar to those performed for the R252 gene (encoding gp275), follow these methodological steps:

  • Design a homologous recombination strategy:

    • Construct a knockout cassette containing a selectable marker flanked by 500-1000 bp homologous to the regions upstream and downstream of the MIMI_L778 gene

    • For additional analysis, consider creating a fluorescent protein fusion construct (similar to the EGFP-tagging approach used for gp275)

  • Virus propagation and transformation:

    • Infect Acanthamoeba castellanii cells with Mimivirus

    • Introduce the knockout construct during infection using lipofection or electroporation

    • Select for recombinant viruses using appropriate selection markers

  • Screening and verification protocol:

    • PCR-based screening to identify successful recombinants

    • Sequence verification of the modified genomic region

    • Quantitative PCR to confirm absence of MIMI_L778 transcripts

  • Phenotypic analysis:

    • Compare replication kinetics between wild-type and knockout viruses

    • Examine virion morphology using electron microscopy

    • Assess DNA packaging and genome organization

    • If viable, analyze transcriptomic changes in knockout vs. wild-type infection

  • Controls to include:

    • Mock-infected Acanthamoeba cells

    • Cells infected with wild-type virus

    • Cells infected with a virus containing a knockout of a non-essential gene

This approach mirrors successful knockout studies of other mimiviral genes while incorporating essential experimental design principles for maintaining validity .

What purification strategies yield the highest purity of recombinant MIMI_L778?

Based on the amino acid sequence and predicted properties of MIMI_L778, the following purification strategy would be methodologically sound:

  • Initial capture step options:

    • IMAC (Immobilized Metal Affinity Chromatography) if His-tagged

    • GST affinity chromatography if GST-tagged

    • Recommended buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, with protease inhibitors

  • Intermediate purification:

    • Ion exchange chromatography based on the theoretical pI of MIMI_L778

    • Recommended: Q Sepharose at pH 8.0 (if pI < 7) or SP Sepharose at pH 6.5 (if pI > 7)

  • Polishing step:

    • Size exclusion chromatography to remove aggregates and achieve high purity

    • Recommended column: Superdex 75 or 200 depending on oligomeric state

  • Special considerations for MIMI_L778:

    • If membrane association is confirmed, include 0.1-0.5% non-ionic detergent (DDM or CHAPS)

    • Include reducing agent (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent disulfide-mediated aggregation

    • Optimize glycerol concentration (10-20%) for long-term stability

  • Quality control assessment:

    • SDS-PAGE to verify purity (≥95% for structural studies)

    • Western blotting for identity confirmation

    • Dynamic light scattering to assess homogeneity

    • Mass spectrometry for accurate mass determination and PTM identification

This methodological approach provides a systematic framework while allowing for adjustments based on empirical observations during the purification process .

What computational approaches can predict potential functions of MIMI_L778?

A comprehensive computational strategy to predict MIMI_L778 function would include:

This methodological approach provides a systematic framework for computational prediction that can generate testable hypotheses about MIMI_L778 function .

How might MIMI_L778 contribute to mimiviral replication and host interaction?

Based on the limited information available about MIMI_L778 and comparison with other mimiviral proteins, several hypotheses regarding its potential roles can be formulated:

  • Potential roles in viral replication:

    • Viral factory formation: The protein might contribute to the organization of viral factories (VF) within host cells, similar to how gp275 co-localizes with viral DNA in the VF .

    • Genome packaging: While not having the same MC1-like domain as gp275, MIMI_L778 might play a complementary role in genome organization or packaging.

    • Virion structure: The hydrophobic C-terminal region suggests potential membrane association, possibly contributing to the internal membrane structure of the virion.

  • Host interaction hypotheses:

    • Host modulation: Many uncharacterized mimiviral proteins function to modulate host cell processes to facilitate viral replication.

    • Immune evasion: The protein could potentially interfere with host defense mechanisms.

    • Host specificity: It might contribute to the virus's ability to infect specific amoeba hosts.

  • Experimental approaches to test these hypotheses:

    • Localization studies using fluorescently tagged MIMI_L778 during infection

    • Co-immunoprecipitation to identify interacting partners

    • Knockout studies to assess impact on viral replication stages

    • Host range studies comparing wild-type and MIMI_L778-modified viruses

  • Control experiments:

    • Parallel analysis of known functional mimiviral proteins

    • Host cell-only controls to distinguish viral-specific effects

    • Time-course experiments to determine when MIMI_L778 is expressed and functional

This systematic approach combines hypothesis generation with methodological rigor to guide experimental investigation of MIMI_L778's role in the mimiviral replication cycle.

How should I design experiments to investigate MIMI_L778 protein-protein interactions?

A comprehensive approach to studying MIMI_L778 protein-protein interactions would include:

  • In vitro interaction methods:

    • Pull-down assays: Using purified recombinant MIMI_L778 as bait

    • Surface Plasmon Resonance (SPR): For quantitative binding kinetics

    • Isothermal Titration Calorimetry (ITC): For thermodynamic parameters

    • Microscale Thermophoresis (MST): For interactions in complex solutions

  • Cellular interaction methods:

    • Co-immunoprecipitation (Co-IP): Using antibodies against MIMI_L778 or its binding partners

    • Proximity Ligation Assay (PLA): For detecting interactions in infected cells

    • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in live cells

    • FRET/FLIM: For studying interaction dynamics

  • High-throughput screening approaches:

    • Yeast two-hybrid screening: Against a library of mimiviral proteins

    • Protein microarrays: For systematic interaction mapping

    • Mass spectrometry-based interactomics: AP-MS or BioID approaches

  • Experimental design considerations:

    ParameterRecommendationRationale
    Protein tagsTest multiple positions (N-term, C-term)Minimize interference with interaction surfaces
    Buffer conditionsScreen multiple conditionsOptimize stability and native conformation
    ControlsInclude non-interacting proteinsDistinguish specific from non-specific interactions
    ValidationUse at least two orthogonal methodsIncrease confidence in observed interactions
  • Data analysis approach:

    • Apply appropriate statistical tests for significance

    • Classify interactions based on affinity/stability

    • Construct interaction networks to visualize relationships

    • Correlate with functional assays to determine biological relevance

This methodological framework ensures a systematic approach to discovering and validating MIMI_L778 protein-protein interactions while adhering to experimental design principles that minimize false positives and negatives .

What controls are essential when studying MIMI_L778 in host cells?

When investigating MIMI_L778 in the context of host cells, implementation of proper controls is critical for valid data interpretation:

  • Negative controls:

    • Mock-infected cells: To establish baseline cellular processes without viral factors

    • UV-inactivated virus: To distinguish between effects requiring active viral replication versus mere presence of viral particles

    • Cells infected with MIMI_L778 knockout virus: To identify specific effects of MIMI_L778

    • Non-targeting antibodies or isotype controls: For immunostaining specificity

  • Positive controls:

    • Cells infected with wild-type virus: To establish normal infection parameters

    • Known mimiviral protein with established function: For comparative analysis (e.g., gp275 for DNA-binding proteins)

    • Well-characterized host-pathogen interactions: To validate experimental systems

  • Technical validation controls:

    • Multiple time points: To capture the dynamic nature of infection

    • Multiple MOIs (Multiplicity of Infection): To assess dose-dependent effects

    • Multiple cell types: To determine cell-type specificity

    • Multiple antibody clones or epitope tags: To confirm specificity of detection

  • Control matrix for MIMI_L778 functional studies:

    Experimental ConditionPurposeKey Measurements
    Uninfected cellsBaselineCell morphology, viability, gene expression
    Wild-type virus infectionPositive controlViral factory formation, virus yield
    MIMI_L778 knockout infectionFunctional assessmentChanges in replication, morphology
    MIMI_L778 complementationValidationRestoration of wild-type phenotype
    Heterologous expressionProtein-specific effectsLocalization, interaction partners
  • Time-matched controls:

    • Synchronize infections to ensure comparable progression

    • Collect samples at consistent time points post-infection

    • Maintain identical culture conditions across experimental groups

This comprehensive control strategy follows established experimental design principles to isolate MIMI_L778-specific effects from general viral or cellular processes .

How can I validate the specificity of MIMI_L778 detection methods?

To ensure specificity in MIMI_L778 detection, implement the following validation approach:

  • Antibody-based detection validation:

    • Immunoblotting against recombinant protein: Confirm recognition of purified protein

    • Peptide competition assays: Pre-incubate antibody with immunizing peptide to block specific binding

    • Multiple antibodies targeting different epitopes: Convergent evidence increases confidence

    • Testing in MIMI_L778 knockout samples: Should show absence of signal

    • Testing against closely related proteins: Demonstrate lack of cross-reactivity

  • Nucleic acid-based detection validation:

    • Multiple primer pairs targeting different regions: Consistent results increase reliability

    • DNase/RNase treatment controls: To distinguish between DNA and RNA detection

    • Sequence verification of amplicons: Confirm identity of detected sequences

    • Standard curves with known quantities: Establish detection limits and linearity

    • No-template and no-reverse-transcriptase controls: To detect contamination

  • Fluorescent protein fusion validation:

    • Free fluorescent protein control: To distinguish fusion-specific localization

    • Multiple fusion orientations (N-terminal vs. C-terminal): To minimize tag interference

    • Functional complementation: Verify that tagged protein retains biological activity

    • Colocalization with other detection methods: Convergent evidence from antibody staining

  • Validation data documentation:

    Validation ParameterAcceptance CriteriaTroubleshooting
    Antibody specificitySingle band of expected MW in Western blotIncrease blocking, adjust antibody concentration
    qPCR specificitySingle peak in melt curve, efficiency 90-110%Redesign primers, optimize annealing temperature
    ColocalizationPearson correlation coefficient >0.8Adjust fixation conditions, antibody combinations
    Signal-to-noise ratio>10:1 for quantitative applicationsOptimize detection parameters, reduce background
  • Reporting standards:

    • Document all validation procedures in methods sections

    • Include validation data in supplementary materials

    • Specify catalog numbers and dilutions for commercial reagents

    • Report all negative results from validation experiments

How should I interpret conflicting data about MIMI_L778 function?

When confronted with conflicting data regarding MIMI_L778 function, apply this systematic interpretation framework:

  • Source evaluation protocol:

    • Methodological differences: Identify variations in experimental approaches that might explain discrepancies

    • Reagent differences: Assess antibody specificity, protein constructs, or detection methods

    • Biological system variations: Consider differences in host cells, viral strains, or experimental conditions

    • Statistical robustness: Evaluate sample sizes, replication levels, and statistical analyses

  • Reconciliation strategies:

    • Context-dependent function hypothesis: Consider that MIMI_L778 may have different functions under different conditions

    • Multi-functional protein model: The protein may have multiple distinct activities

    • Indirect effects assessment: Observed phenotypes might represent downstream consequences rather than direct functions

    • Temporal considerations: Function may vary across infection stages

  • Resolution experiments:

    • Design crucial experiments that directly test competing hypotheses

    • Use orthogonal methods to validate key observations

    • Perform dose-response or time-course studies to capture dynamic behaviors

    • Collaborate with groups reporting conflicting results to standardize methods

  • Decision matrix for conflicting data:

    Conflict TypeAssessment ApproachResolution Strategy
    Localization discrepanciesCompare fixation methods, detection antibodiesSide-by-side comparison with standardized protocols
    Functional effectsEvaluate knockout phenotype variablesComplementation studies with defined mutants
    Interaction partnersCompare detection methods, stringencyValidate key interactions with multiple techniques
    Structural predictionsAssess modeling assumptionsObtain experimental structural data
  • Transparent reporting approach:

    • Acknowledge conflicting data in publications

    • Present alternative interpretations

    • Propose testable models that might reconcile discrepancies

    • Distinguish between observations and interpretations

This methodological framework ensures a systematic approach to handling conflicting data while maintaining scientific rigor and transparency .

What statistical approaches are appropriate for MIMI_L778 interaction studies?

For robust statistical analysis of MIMI_L778 interaction studies, implement the following methodological framework:

  • Experimental design considerations:

    • Power analysis: Determine appropriate sample sizes before experiments

    • Randomization: Randomly assign samples to experimental groups

    • Blinding: Analyze data without knowledge of sample identity when possible

    • Replication strategy: Include both technical and biological replicates

  • Statistical test selection guide:

    Data TypeRecommended TestsConsiderations
    Binding affinitiesNon-linear regression, Scatchard analysisCheck for cooperativity, multiple binding sites
    Co-localizationPearson's/Mander's coefficients, Costes randomizationAccount for random overlap, intensity correlations
    Interaction networksPermutation tests, topology analysisControl for network size, connectivity biases
    Time-course interactionsRepeated measures ANOVA, mixed modelsAccount for temporal autocorrelation
  • Multiple testing correction approaches:

    • Bonferroni correction for small numbers of planned comparisons

    • False Discovery Rate (FDR) methods for large-scale interaction screens

    • Family-wise error rate control for proteomics datasets

  • Validation of assumptions:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Assess homogeneity of variance with Levene's or Bartlett's tests

    • Consider non-parametric alternatives when assumptions are violated

    • Evaluate residuals for patterns suggesting model inadequacies

  • Effect size reporting:

    • Calculate and report Cohen's d, odds ratios, or other appropriate measures

    • Include confidence intervals for all effect size estimates

    • Compare effect sizes across different interaction partners

  • Reproducibility enhancement:

    • Pre-register analysis plans when possible

    • Make raw data and analysis scripts available

    • Clearly distinguish between exploratory and confirmatory analyses

    • Report all tested hypotheses, including negative results

How can I determine if observed phenotypes are specifically due to MIMI_L778?

To establish causality between MIMI_L778 and observed phenotypes, implement this methodological framework:

  • Genetic manipulation approaches:

    • Knockout/knockdown: Remove MIMI_L778 and observe phenotypic changes

    • Complementation: Reintroduce MIMI_L778 to knockout strains to restore phenotype

    • Point mutations: Create specific mutations in functional domains to link structure to function

    • Dose-dependence: Vary expression levels to observe corresponding phenotypic changes

  • Temporal control strategies:

    • Inducible expression systems: Activate or repress MIMI_L778 at specific timepoints

    • Time-course analysis: Track phenotype development relative to MIMI_L778 expression

    • Single-cell analyses: Correlate MIMI_L778 levels with phenotypic variations in individual cells

  • Specificity controls:

    • Rescue experiments: Express MIMI_L778 in trans to restore function

    • Cross-species complementation: Test functional conservation across related viruses

    • Domain swapping: Replace domains to attribute function to specific regions

    • Off-target effect assessment: Rule out secondary effects of genetic manipulations

  • Causality determination decision tree:

    Evidence TypeStrengthAdditional Validation Required
    Correlation onlyWeakGenetic manipulation, temporal analysis
    Knockout phenotypeModerateComplementation, specificity controls
    Knockout + complementationStrongPoint mutations to identify critical residues
    Structure-function validatedVery strongBiochemical mechanism elucidation
  • Alternative explanation assessment:

    • Systematically evaluate other viral factors that might explain the phenotype

    • Test for indirect effects through host response pathways

    • Consider combinatorial effects with other viral proteins

    • Examine pleiotropic effects versus direct causation

This methodological framework provides a systematic approach to establishing causality between MIMI_L778 and observed phenotypes, following established principles of experimental design and causal inference .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.