Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L817 (MIMI_L817)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_L817; Uncharacterized protein L817
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_L817
Target Protein Sequence
MSGSVNQNTDQHSQDSSSTPNNKLTKTLASLDDSTLEFAVDVLSHLPLIRRSLNYAKNLL VRLFVMYMIVQVSYYIVPFVLLVLFGYNQSTPDMKFAIQLQVLVVSRGIIDGIIGVLQFI FWFWIFVDLIRFLFGYAKNKVN
Uniprot No.

Target Background

Database Links

KEGG: vg:9925480

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does MIMI_L817 compare to other characteristically similar mimiviral proteins?

When comparing MIMI_L817 to other mimiviral proteins, it's important to consider it in the context of the broader architectural proteins encoded by mimiviruses. Recent research has identified other mimiviral proteins with DNA-binding capabilities, such as gp275 (coded by gene R252), which contains a MC1-like domain involved in DNA compaction and organization within the viral capsid .

Unlike the better-characterized gp275 protein, which shows homology to archaeal DNA-binding proteins, MIMI_L817 currently lacks definitive functional domain annotations. Comparative analysis between these proteins could provide insights into the functional diversity of mimiviral architectural proteins and their roles in genome packaging and organization .

What experimental approaches are recommended for initial characterization of MIMI_L817?

For initial characterization of MIMI_L817, a systematic approach combining biophysical, biochemical, and functional assays is recommended:

  • Structural analysis: Begin with circular dichroism (CD) spectroscopy to determine secondary structure elements, followed by more advanced techniques such as X-ray crystallography or cryo-EM for tertiary structure.

  • Protein-protein interaction studies: Employ pull-down assays, co-immunoprecipitation, or yeast two-hybrid screens to identify potential binding partners within the mimivirus proteome.

  • DNA-binding assessment: Given that other mimiviral proteins show DNA-binding capabilities, conduct electrophoretic mobility shift assays (EMSAs) and surface plasmon resonance (SPR) to evaluate potential nucleic acid interactions .

  • Localization studies: Develop fluorescently tagged versions of MIMI_L817 to track its subcellular localization during viral infection cycles.

  • Gene knockout studies: Similar to approaches used for gp275, CRISPR-based gene editing or other knockout methods could reveal phenotypic consequences of MIMI_L817 deletion .

These complementary approaches provide a foundation for functional characterization while minimizing experimental bias.

What are the optimal conditions for recombinant expression of MIMI_L817?

Based on available information, successful recombinant expression of MIMI_L817 has been achieved using E. coli expression systems with an N-terminal His-tag . The following optimizations are recommended:

  • Expression vector selection: pET-based vectors under the control of T7 promoter have shown good results for viral proteins.

  • E. coli strain considerations: BL21(DE3) or Rosetta(DE3) strains are suitable, with the latter providing additional tRNAs for rare codons if codon optimization hasn't been performed.

  • Induction parameters: Initial testing should compare IPTG concentrations (0.1-1.0 mM) and induction temperatures (16°C, 25°C, and 37°C), with lower temperatures often yielding higher amounts of soluble protein.

  • Expression time course: Monitor expression at 4, 6, 8, and overnight timepoints to determine optimal harvesting time.

  • Culture media optimization: Compare standard LB with enriched media such as TB or 2xYT to enhance yield.

Experimental design should include proper controls and replication to ensure reliable results, following principles of good experimental design to reduce variability and improve power to detect differences in expression conditions .

What purification strategies yield the highest purity and activity of MIMI_L817?

A multi-step purification strategy is recommended to achieve high purity while maintaining native conformation and activity:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is suitable for His-tagged MIMI_L817 .

  • Intermediate purification: Ion exchange chromatography based on the protein's theoretical pI to remove closely related contaminants.

  • Polishing step: Size exclusion chromatography to separate oligomeric states and remove aggregates.

  • Buffer optimization: Testing multiple buffer compositions is crucial, particularly given the potential membrane-associated properties suggested by the amino acid sequence. Consider including stabilizing agents such as glycerol (5-10%) or mild detergents if hydrophobic regions cause aggregation.

  • Quality control: Assess final purity by SDS-PAGE (>90% purity is desirable) and verify identity via Western blot and/or mass spectrometry .

The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability, and aliquoted to avoid repeated freeze-thaw cycles .

How can researchers troubleshoot common issues in MIMI_L817 expression and purification?

When encountering challenges with MIMI_L817 expression and purification, consider these systematic troubleshooting approaches:

  • Poor expression yield:

    • Optimize codon usage for E. coli

    • Test different fusion tags (MBP, SUMO, GST) which may enhance solubility

    • Evaluate co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Try auto-induction media as an alternative to IPTG induction

  • Protein insolubility:

    • Lower induction temperature to 16°C

    • Reduce IPTG concentration to 0.1-0.2 mM

    • Add solubility enhancers to lysis buffer (detergents, increased salt concentration)

    • Consider refolding from inclusion bodies if native conditions fail

  • Degradation during purification:

    • Include protease inhibitor cocktail in all buffers

    • Perform purification at 4°C

    • Minimize purification time by optimizing protocols

    • Test alternative buffer compositions

  • Poor binding to Ni-NTA:

    • Verify tag accessibility (N vs C-terminal positioning)

    • Reduce imidazole in binding buffer

    • Check pH of binding buffer (optimal range 7.5-8.5)

    • Ensure reducing agents haven't compromised the resin

A thoughtful experimental design that incorporates appropriate controls for each troubleshooting step will enable more precise identification of problematic variables .

What bioinformatic approaches can help predict potential functions of MIMI_L817?

Given the uncharacterized nature of MIMI_L817, comprehensive bioinformatic analysis serves as a critical first step toward functional prediction:

  • Advanced sequence homology searches:

    • Position-Specific Iterated BLAST (PSI-BLAST) to detect remote homologies

    • Hidden Markov Model (HMM) profile searches against protein family databases

    • Structure-based homology detection using threading algorithms (I-TASSER, Phyre2)

  • Structural prediction and analysis:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Prediction of binding sites and functional pockets

    • Comparison with known DNA/RNA binding proteins similar to the analysis performed for gp275

  • Genomic context analysis:

    • Examine neighboring genes in the mimivirus genome

    • Identify conserved gene clusters across related viruses

    • Apply guilt-by-association principles for functional inference

  • Disorder prediction and post-translational modification sites:

    • Identify intrinsically disordered regions using PONDR or IUPred

    • Predict potential phosphorylation, glycosylation, or other modification sites

  • Comparative analysis with other viral architectural proteins:

    • Compare with the MC1-like domain in gp275 and other mimivirus proteins

    • Evaluate evolutionary relationships with archaeal DNA-binding proteins

This multi-layered bioinformatic approach provides testable hypotheses for subsequent experimental validation.

How can researchers design experiments to determine if MIMI_L817 interacts with DNA similar to other mimiviral proteins?

To investigate potential DNA-binding properties of MIMI_L817, similar to those observed in gp275 , a systematic experimental approach is recommended:

  • In vitro DNA binding assays:

    • Electrophoretic Mobility Shift Assay (EMSA) using various DNA substrates (linear, circular, single-stranded, double-stranded)

    • Fluorescence Anisotropy to quantify binding affinity and kinetics

    • Surface Plasmon Resonance (SPR) for real-time binding analysis

    • Microscale Thermophoresis (MST) to determine dissociation constants

  • DNA compaction assessment:

    • Atomic Force Microscopy (AFM) to visualize DNA compaction upon protein binding

    • Light scattering techniques to measure changes in DNA hydrodynamic properties

    • Single-molecule stretching experiments using optical tweezers

  • Binding specificity determination:

    • DNase I footprinting to identify protected DNA regions

    • SELEX (Systematic Evolution of Ligands by Exponential Enrichment) to identify preferred binding sequences

    • ChIP-seq if antibodies against MIMI_L817 are available

  • Structural studies of protein-DNA complexes:

    • NMR spectroscopy for smaller complexes

    • X-ray crystallography or cryo-EM for larger assemblies

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Functional consequences of binding:

    • Effect on DNA replication using in vitro replication assays

    • Impact on transcription using in vitro transcription systems

    • Comparison with the functional effects of gp275 binding

This comprehensive approach will help identify whether MIMI_L817 shares functional similarities with other DNA-binding proteins in mimiviruses.

What approaches can determine the role of MIMI_L817 in the mimivirus replication cycle?

To elucidate the role of MIMI_L817 in the mimivirus replication cycle, a multi-faceted approach combining genetic, biochemical, and imaging techniques is recommended:

  • Gene knockout or knockdown studies:

    • CRISPR-Cas9 mediated gene editing (if applicable to mimivirus)

    • Antisense RNA strategies to reduce expression

    • Similar to approaches used for gp275, which was shown to be essential for viral multiplication

  • Temporal expression analysis:

    • qRT-PCR to determine expression kinetics throughout infection

    • Proteomics to quantify protein levels at different stages

    • Comparison with known early, intermediate, and late viral genes

  • Localization studies:

    • Immunofluorescence microscopy using specific antibodies

    • Electron microscopy with immunogold labeling

    • Live-cell imaging with fluorescently tagged protein

  • Interaction network mapping:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • Yeast two-hybrid or mammalian two-hybrid screens

  • Functional complementation:

    • Rescue experiments in knockout systems

    • Domain swapping with other viral proteins

    • Heterologous expression in related viruses

By integrating data from these approaches, researchers can build a comprehensive model of MIMI_L817's role in the mimivirus life cycle, similar to the insights gained for gp275 .

How does MIMI_L817 compare to architectural proteins in other viral systems?

Comparing MIMI_L817 to architectural proteins in other viral systems provides evolutionary and functional context:

  • Comparison with other giant virus architectural proteins:

    • Analyze similarities with proteins from related NCLDVs (Nucleocytoplasmic Large DNA Viruses)

    • Compare with the MC1-like domain-containing gp275 protein in mimivirus

    • Examine potential functional convergence with marseillevirus architectural proteins

  • Comparison with bacteriophage DNA packaging proteins:

    • Analyze structural and functional similarities with phage protamine-like proteins

    • Compare mechanisms of DNA condensation and packaging

    • Evaluate evolutionary relationships and potential horizontal gene transfer

  • Comparison with eukaryotic viral architectural proteins:

    • Analyze similarities with herpesvirus DNA packaging proteins

    • Compare with adenovirus core proteins

    • Evaluate functional equivalence despite potentially different origins

  • Evolutionary analysis:

    • Phylogenetic placement relative to archaeal MC1 proteins

    • Investigation of potential horizontal gene transfer events

    • Assessment of selective pressures through Ka/Ks ratios

This comparative approach may reveal conserved mechanisms of viral DNA organization across different viral families and provide insights into the evolutionary origins of MIMI_L817.

What experimental approaches can elucidate the three-dimensional structure of MIMI_L817?

Determining the three-dimensional structure of MIMI_L817 requires a multi-technique approach:

  • X-ray crystallography:

    • Optimize protein purity and homogeneity (>95% by SDS-PAGE)

    • Perform crystallization screening (vapor diffusion, microbatch, lipidic cubic phase)

    • Consider surface entropy reduction mutations to promote crystallization

    • Use molecular replacement based on predicted structures or de novo phasing

  • Cryo-electron microscopy:

    • Particularly valuable if MIMI_L817 forms larger oligomeric assemblies

    • Single-particle analysis for high-resolution structure determination

    • Tomography for in situ structural analysis within viral particles

  • NMR spectroscopy:

    • Suitable for analyzing dynamic regions or smaller domains

    • Requires isotopic labeling (15N, 13C, 2H) during expression

    • Can provide information on protein-DNA interactions in solution

  • Integrative structural biology approaches:

    • Combine low-resolution techniques (SAXS, SANS) with high-resolution methods

    • Use crosslinking mass spectrometry to define spatial constraints

    • Validate computational models with experimental data

  • AlphaFold2 and other AI-based predictions:

    • Generate initial structural models to guide experimental approaches

    • Similar to the structural prediction approach used for gp275

    • Validate predictions with limited experimental data (CD spectroscopy, SAXS)

The structural information obtained would significantly advance understanding of MIMI_L817's function and potential interactions with viral DNA or other proteins.

How can researchers investigate potential interactions between MIMI_L817 and host cellular components?

Investigating MIMI_L817 interactions with host cellular components requires approaches that span molecular to cellular scales:

  • Protein-protein interaction screening:

    • Affinity purification-mass spectrometry using tagged MIMI_L817

    • Yeast two-hybrid screening against host cDNA libraries

    • Protein microarray screening against host proteins

    • Proximity labeling approaches (BioID, APEX) in infected cells

  • Subcellular localization during infection:

    • Immunofluorescence microscopy with organelle markers

    • Live-cell imaging with fluorescently tagged protein

    • Subcellular fractionation followed by western blotting

    • Correlative light and electron microscopy for high-resolution localization

  • Functional interference assays:

    • Host protein knockdown/knockout effects on MIMI_L817 function

    • Competition assays with host proteins for binding sites

    • Dominant-negative mutants to disrupt specific interactions

  • Host response analysis:

    • Transcriptomic analysis of host cells expressing MIMI_L817

    • Phosphoproteomics to identify signaling pathways affected

    • Chromatin immunoprecipitation to identify potential binding to host DNA

  • In vitro reconstitution:

    • Reconstitute minimal interaction systems with purified components

    • Biochemical assays to characterize interaction mechanisms

    • Structural studies of complexes with host factors

These approaches would help determine whether MIMI_L817 directly interacts with host components during infection, potentially revealing novel aspects of mimivirus-host biology.

What are the key physical and chemical properties of MIMI_L817 relevant to experimental design?

The following table summarizes the key properties of recombinant MIMI_L817 that researchers should consider when designing experiments:

PropertyValueExperimental Relevance
Amino Acid Length142 aa Impacts expression yield and purification strategy
Molecular Weight~16 kDa (estimated)Guides gel filtration and SDS-PAGE analysis
Expression SystemE. coli Determines experimental protocols and reagents
Fusion TagN-terminal His-tag Influences purification approach and antibody selection
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0 Critical for maintaining stability during experiments
Storage Condition-20°C/-80°C, avoid freeze-thaw Preserves activity for downstream assays
ReconstitutionDeionized water, 0.1-1.0 mg/mL Ensures proper solubility for functional studies
Recommended Glycerol5-50% final concentration Prevents aggregation during long-term storage

These properties should be considered baseline information for experimental design, with optimization required for specific applications.

What methodological controls are essential when conducting functional studies on MIMI_L817?

When designing experiments to investigate MIMI_L817 function, the following controls are essential to ensure robust and reproducible results:

  • Protein quality controls:

    • Heat-denatured MIMI_L817 to distinguish specific from non-specific effects

    • Tag-only protein to control for tag-mediated artifacts

    • Unrelated protein of similar size and charge characteristics

    • Empty vector controls for cellular expression studies

  • DNA binding assay controls:

    • Non-specific DNA competitors (e.g., poly dI-dC)

    • Known DNA-binding proteins as positive controls

    • Titration series to establish dose-dependency

    • Buffer-only and BSA controls to assess non-specific interactions

  • Functional assay controls:

    • Similar mimivirus proteins (e.g., gp275) as comparative controls

    • Temporal controls to account for infection stage-specific effects

    • Host cell-type controls to identify cell-specific responses

    • Mutant versions with altered predicted functional domains

  • Experimental design controls:

    • Biological replicates (minimum n=3) for statistical validity

    • Technical replicates to assess methodological variation

    • Randomization and blocking designs to minimize bias and variability

    • Appropriate positive and negative controls for each assay type

  • Data analysis controls:

    • Normalization standards for quantitative comparisons

    • Statistical tests appropriate for data distribution

    • Multiple testing corrections for large-scale studies

    • Effect size calculations to assess biological significance

Implementing these controls follows good experimental design principles, reducing the risk of bias and confounding factors while improving statistical power .

What are the most promising research directions for further characterizing MIMI_L817?

Based on current knowledge and emerging research on mimivirus proteins, several high-priority research directions for MIMI_L817 are recommended:

  • Comprehensive structural characterization:

    • Determine high-resolution structure using crystallography or cryo-EM

    • Map functional domains and interaction interfaces

    • Compare structural features with the MC1-like domain in gp275

  • Genetic manipulation studies:

    • Develop gene knockout/knockdown systems similar to those used for gp275

    • Perform complementation studies with mutant variants

    • Assess phenotypic consequences across the viral replication cycle

  • Interaction network mapping:

    • Identify viral and host protein interaction partners

    • Map DNA-binding specificities and genomic targets

    • Determine position within the hierarchy of viral nucleoprotein complex assembly

  • Comparative analysis across viral families:

    • Expand phylogenetic analysis beyond mimivirus lineages

    • Identify functional equivalents in other viral systems

    • Trace evolutionary history and potential horizontal gene transfer events

  • Translational applications exploration:

    • Evaluate potential as antiviral target

    • Assess utility as diagnostic marker for mimivirus infection

    • Investigate applications in DNA condensation technologies

These research directions build upon existing knowledge while expanding into novel areas that could significantly advance understanding of mimivirus biology and potentially lead to practical applications.

How might understanding MIMI_L817 contribute to broader knowledge of viral genome organization?

Characterizing MIMI_L817 has significant implications for understanding fundamental aspects of viral genome organization:

  • Evolutionary insights: The presence of potential DNA-binding proteins like MIMI_L817 in mimiviruses provides a unique opportunity to study the convergent evolution of genome packaging strategies across different domains of life. Like gp275 with its MC1-like domain , MIMI_L817 may represent another example of how viruses have acquired or evolved architectural proteins for genome compaction.

  • Comparative virology: Understanding MIMI_L817's role would enable comparative analyses with DNA packaging mechanisms in other large DNA viruses, potentially revealing conserved principles or unique adaptations specific to giant viruses.

  • Host-virus interactions: If MIMI_L817 interacts with host chromatin or DNA-binding proteins, its characterization could reveal novel aspects of how viruses manipulate host nuclear processes during infection.

  • Fundamental biophysics: Studying how MIMI_L817 potentially contributes to DNA compaction could provide insights into the biophysical principles governing genome organization in confined spaces, applicable beyond virology to general chromosome biology.

  • Viral assembly mechanisms: Determining MIMI_L817's role in genome packaging would enhance understanding of the assembly pathway of giant viruses, potentially identifying critical steps that could be targeted for antiviral development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.